KEGG   Aliivibrio salmonicida: VSAL_I1123Help
Entry
VSAL_I1123        CDS       T00782                                 

Gene name
vasR
Definition
(GenBank) putative type VI secretion protein VasR
  KO
K11900  type VI secretion system protein ImpC
Organism
vsa  Aliivibrio salmonicida
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vsa02044]
    VSAL_I1123 (vasR)
Secretion system [BR:vsa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VSAL_I1123 (vasR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB DUF826
Motif
Other DBs
NCBI-ProteinID: CAQ78808
UniProt: B6EJ77
Position
1:complement(1224773..1226248)
Genome map
AA seq 491 aa AA seqDB search
MSETSTAQEIQKETTIGLLDQIVAQTNLTPEDETYGIAKRGVSAFIQELLKPHNQSEPVK
KALIDKMITEIDQRLSTQVDEILHHSSFQQLESAWRGLKLLVDRTDFRENTKIEIINISK
KDLLEDFEDASDITQSGLYKHVYTNEFGTFGGQPVGAIIGNYDFGPSAPDIKNLQNVAAV
AAMAHAPFISAAGPKFFGLDSFEGLPDLKDLNDHFESPQYAKWQSFRDQEDARYVGLTLP
RFLLRQPYDPEENPVKTFNYHENVSATHEDYLWGNTAFTMASRVTESFANFRWCPNIIGP
QSGGTVEDLPLHHFDSMGDIETKIPTEVLVSDRREFELAEEGFIALTMRKGSDNAAFFSA
NSVQKAKLFGNSEEGKSAELNYRLGTQLPYLFIISRLAHYIKVLQREQIGSWKEPTDLER
ELNTWIRQYITDQENPPAEVRSRRPLRAASIEVIDVEGSPGWYKVNLSVRPHFKYMGSDF
TLSLVGKLDQE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacaagcacagcccaagaaatacaaaaagaaacaacgataggtctccttgat
caaatcgttgctcaaactaatttaacaccagaggatgaaacctatggtattgctaaacgt
ggcgtcagcgcatttattcaagagctattgaaacctcataatcaatctgagccggttaaa
aaagcattaatcgacaaaatgatcacagaaattgatcagcgcttgagtactcaagttgat
gaaatattacatcactcttcatttcagcagcttgagtctgcttggagaggactcaagtta
ttagtagatcgcaccgattttcgagagaacacaaaaattgaaatcatcaacatctctaaa
aaggatctactcgaagattttgaagatgcttctgacatcactcaatccggtttatacaaa
catgtctatacgaatgaatttggtacatttggtggtcaacctgtcggtgctattattggt
aattatgattttggcccttctgcacccgatattaaaaatctacaaaatgtggcggctgta
gccgcaatggctcatgccccttttatttcagcggcgggtcctaaattttttggattagat
tcttttgaagggttgcctgatctcaaagatcttaatgatcatttcgaaagcccacaatat
gcaaaatggcagagttttagagatcaagaagacgcccgttacgttgggttaaccttacca
cgctttttacttcgtcaaccttatgaccctgaagaaaacccagtaaaaacatttaactac
catgagaatgtatctgcaactcatgaagattacctatggggtaataccgcgtttactatg
gcctctcgagtcactgaaagctttgctaatttccgttggtgtccaaatattatcggccct
caatctggtggtactgttgaagaccttccattgcatcattttgacagcatgggagatatc
gaaacaaaaatacccactgaagttttagtgtctgatcgccgtgaattcgaactagcagaa
gaaggatttatcgccttaaccatgcgtaaaggttcagataatgcggcttttttctctgct
aattcggttcaaaaagccaaattatttggtaattctgaagaaggaaaaagtgcagaacta
aattacaggttgggaactcaactcccttacttatttattattagccgcttagcacattac
ataaaagtactacaacgagaacaaattggcagctggaaagagcctaccgatcttgaaaga
gaattgaatacgtggataagacaatacattactgatcaagaaaatccaccagcagaagtg
agaagccgtcgtccattacgcgccgcaagcattgaagttatcgatgttgaaggaagccct
ggttggtacaaagtaaatttatccgttcgccctcattttaaatatatgggttctgatttt
actttgtcactcgttggtaagttagatcaagaataa

DBGET integrated database retrieval system