KEGG   Aliivibrio salmonicida: VSAL_I1124
Entry
VSAL_I1124        CDS       T00782                                 

Gene name
vasQ
Definition
(GenBank) putative type VI secretion protein VasQ
  KO
K11901  type VI secretion system protein ImpB
Organism
vsa  Aliivibrio salmonicida
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vsa02044]
    VSAL_I1124 (vasQ)
Secretion system [BR:vsa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VSAL_I1124 (vasQ)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAQ78809
UniProt: B6EJ78
Position
1:complement(1226252..1226746)
AA seq 164 aa
MSKDGSVAPKERINVTFKPSSGDAAEALELPLKMMVLGDFTLQQDDRKLEDRKPLNIDKS
NFNDVIEKQDLNIEFGVKNRLQDDENEEIPVNLSFKNMTDFDPSSIVEQVPELKGLMDLR
EALVSLKGPLGNVPAFRKAIEDALVNDEAREKLLSELGLVTEKE
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcaaaagacggatctgtagcgccaaaagagcgcataaatgtgacatttaaaccatcg
tcaggtgatgcggcggaggcacttgaacttcctttaaaaatgatggtactaggtgatttt
acactgcagcaagatgatcgaaaattggaagatcgtaagcctctcaacattgataaaagt
aacttcaatgatgtgatagaaaaacaagatttaaatattgaatttggtgtaaaaaatcgc
cttcaagatgatgaaaatgaagagatcccagtaaacctttcattcaagaacatgactgat
tttgaccctagcagtatcgtagagcaagtccctgagctaaagggattaatggatttacgc
gaggcacttgtttccctaaaaggtccattaggtaatgttcctgcatttagaaaagcaatt
gaagatgcattagtcaatgacgaagctcgtgaaaagctattaagtgaattaggtttagtg
acggaaaaggaataa

DBGET integrated database retrieval system