KEGG   Aliivibrio salmonicida: VSAL_I1134Help
Entry
VSAL_I1134        CDS       T00782                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00340  Histidine metabolism
vsa01100  Metabolic pathways
vsa01110  Biosynthesis of secondary metabolites
vsa01230  Biosynthesis of amino acids
Module
vsa_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    VSAL_I1134 (hisD)
Enzymes [BR:vsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     VSAL_I1134 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh PAP_fibrillin
Motif
Other DBs
NCBI-ProteinID: CAQ78819
UniProt: B6EJ88
Position
1:1237380..1238675
Genome map
AA seq 431 aa AA seqDB search
MKTLVWQSLSNSQQDTVLQRPAITEGANITAAVTSVINTVKQDGDAGVLALTEKFDKVKP
ESIRVSKSEIDAASERLSEKMKAALQQAYSNISKFHKAQKPQPIKVETQPGVVCEQITMP
VNKVGLYIPGGSAPLPSTVLMLGIPAQIAGCHKVVLCSPPPIADEILYVAKLCKVDEVYN
IGGAQAIAAMAYGTESVSKVDKIFGPGNAYVTEAKRQVSNDFRGAAIDMPAGPSEVLVIA
DETADPDFIAADLLSQAEHGPDSQVILVTPSPIIADQVADAIEKQLKELTRADIARQALG
SSLLIIAKSLTQCVSISNFYGPEHLIVQTKNPRELLPLLDNAGSIFLGEYSPESAGDYAS
GTNHVLPTYGYTRTHSSLGLADFSKRMTVQELTADGLKGLAPTVVTMADAEGLDAHKRAV
TIRIEKLAKLN
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccctagtttggcaatcactcagtaattcacaacaagacaccgtcttacagcgt
cctgctattaccgaaggcgcaaatattaccgctgcggtaactagcgtgattaataccgtt
aaacaagatggcgatgctggcgtgttagcgttgactgaaaagtttgataaggtgaaacct
gaatccattcgtgtatctaaatcagagattgatgcggcaagtgaacgtttatctgaaaag
atgaaagcggcactgcaacaagcttatagcaatatttctaagtttcataaagcacaaaag
cctcagccaatcaaagttgaaactcaacctggtgtcgtatgtgaacaaatcacgatgcca
gtgaataaagtcggcttgtatattccgggtggcagtgcaccattgccttcaacagtatta
atgttaggcattcctgcacagattgcgggctgtcataaagtggtactttgttcgccaccg
ccgattgctgatgagatcttatacgttgcaaaactatgtaaagtcgatgaggtgtataac
attggtggcgcacaagcgattgctgctatggcgtatggtactgaatctgtttctaaagta
gataagatctttggcccaggtaacgcatacgtcactgaagcaaaacgccaagtttctaat
gactttcgtggtgctgctattgatatgcctgcgggaccttctgaagtcttggttattgcg
gatgaaacggctgatcctgattttattgcggcagatcttcttagccaagctgaacatggt
cctgattcacaagttatcttagtcacgccttcgccaatcatcgctgatcaagttgctgat
gccatcgagaagcaattaaaagaactgactcgtgcggatatcgctcgtcaagcgctaggt
tctagtttgttgattattgctaaatcattgacgcaatgtgtttcaatctcaaacttttat
ggtcctgagcacttgattgttcaaactaaaaacccacgtgaattattaccattgctagat
aatgcaggttctattttcttgggtgagtattctccagaatcagcaggggattatgcatcg
ggtacaaaccatgttttaccaacttatggttatacaagaacgcactcaagcttaggttta
gctgatttttctaaacgcatgacagtacaagagttaactgctgatggtttaaaagggtta
gcgccaacggttgtcacaatggctgatgctgaagggctagatgcacataaacgtgccgtg
actattcgaattgaaaaattagctaaattgaattaa

DBGET integrated database retrieval system