KEGG   Aliivibrio salmonicida: VSAL_I1171
Entry
VSAL_I1171        CDS       T00782                                 

Gene name
vasQ-1
Definition
(GenBank) putative type VI secretion protein VasQ-1
  KO
K11901  type VI secretion system protein ImpB
Organism
vsa  Aliivibrio salmonicida
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vsa02044]
    VSAL_I1171 (vasQ-1)
Secretion system [BR:vsa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VSAL_I1171 (vasQ-1)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAQ78856
UniProt: B6EJJ2
Position
1:1274890..1275399
AA seq 169 aa
MALNSQHKRVSKNRVSITYDVETNGAVETKELPFVVGVIGDFSGHKSESEKVDLEEREFT
SIDKDNFDMVMGQVAPTLSYKVDNKLASDESQFEVNMNFSSMKDFHPESVVEQIDPLKKL
VETRNQLKVLLSKADRSRDLERLLKEILQSTDAIQGLAQELGLNNEGAE
NT seq 510 nt   +upstreamnt  +downstreamnt
atggctttgaattcacaacataagcgtgttagtaaaaaccgtgtaagtattacttatgat
gttgaaacaaacggcgcggtagaaaccaaagaattaccatttgttgttggtgttattggc
gatttttctggacataaatcagaatcagaaaaagttgatttagaagagcgcgaatttaca
agtattgataaagataatttcgatatggtaatgggtcaagtcgccccaacgctctcttat
aaagttgataataaattagcgagtgatgaaagccaatttgaagtgaatatgaatttcagc
tcaatgaaagattttcatcctgagagcgtggtagaacaaatagatccattgaagaagtta
gtagaaactcgtaatcaacttaaagtgctattaagtaaagcggatcgttctagagatctt
gagcgattactaaaagaaatcctacaaagtacagatgcaattcaaggtttagcgcaagaa
ttgggtctgaataacgaaggagctgaataa

DBGET integrated database retrieval system