KEGG   Aliivibrio salmonicida: VSAL_I1173
Entry
VSAL_I1173        CDS       T00782                                 

Gene name
vasRB-1
Definition
(GenBank) putative type VI secretion protein VasRB-1
  KO
K11899  type VI secretion system protein ImpD
Organism
vsa  Aliivibrio salmonicida
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vsa02044]
    VSAL_I1173 (vasRB-1)
Secretion system [BR:vsa02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   VSAL_I1173 (vasRB-1)
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: CAQ78858
UniProt: B6EJJ4
Position
1:1276930..1278291
AA seq 453 aa
MNTINQSITMQSELICLPWEELLSLSQKGKTAQFKVLITKLIANLDRVISEQLSTVMQDK
HFKKLEASWLDLQLLTEKQVSSRRVKVKILDLSWSMVSDDLNYSFEIKQTALFKRLYANE
FDTGGGTPFGLVVIDHKITSDYGEDEDHDDLYTLQLLSELAERSLCPVVLGVDEFFFGDD
PNRQLHDNVRVKRILDSRDFLSWQLLRDKASSRFLHLVLPEYLQRRPYQNYAAGFIFTES
NYRDNALWGNSAYLLAGNVIQEFERISWFGFLRSYNETGTYGAIIQHDLSLTAKVDIYNE
DDGFWAEQGFVPLSSLYLTEQKGFFSNQSVWKASTEELQMLGTLQTNLMACRFGHYIKAQ
LRDQIGRYDSMEDCKRGLENWLKSYISEVDYGEDSVMARYPLKASEVRIKEDSQDSTRYL
CEIMLQPQYQYEMMDAQVLLTTSMPDQAVGGSA
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgaatacaatcaatcaatcaataacgatgcaatcagagttaatatgcttaccttgggag
gaattattatcactctctcaaaaaggcaaaactgctcaatttaaagtattgattactaaa
ctaatcgctaatttagatcgtgtgattagcgaacaactttcaacagttatgcaagacaaa
cactttaaaaaactggaagcaagttggcttgatcttcagttattgacagaaaaacaagtc
tcatcgcgaagagttaaagttaaaatattagatctaagttggagcatggtgtcagatgat
ctaaattactcgtttgaaataaagcagactgctctatttaaaagattatacgccaatgaa
tttgatactggaggtgggaccccttttggtcttgttgttattgatcataaaattacgtct
gattatggtgaagatgaagaccatgatgacctttatactttgcaactattatcagagctt
gcggagcgctcgttatgtccagtggtgctaggggttgatgagtttttcttcggtgatgat
cctaatcgccaactacatgataacgtgagagtaaaacgaattttagatagtcgtgatttt
ctttcatggcaattattaagagataaagcctcttctcgttttttgcatttggttttacct
gagtatttacaacgtcgtccttatcaaaattatgctgcggggtttatttttactgaaagt
aattatcgtgataatgcgctttggggaaacagtgcgtatttacttgcaggaaatgttatt
caagaatttgaacgcattagttggtttggttttttgcgttcatataatgaaacaggtaca
tatggagcgatcattcaacatgatttatcacttaccgctaaagttgatatttataatgag
gatgatggtttttgggcagaacaaggttttgttccactaagtagtttgtatttaacggaa
caaaaaggattctttagtaatcaatcggtttggaaagcatcaacagaagaactccaaatg
ttggggacgttacaaactaacttaatggcatgtcgtttcgggcactatattaaagctcag
ctccgagatcaaatcggccgttacgatagcatggaagattgcaaacgtggtttagagaac
tggttaaaatcttatattagtgaagtcgattatggtgaagattcagtgatggctcgttat
ccattaaaagcgagtgaagtacgtatcaaagaagatagccaagacagcactcgttattta
tgcgaaatcatgcttcagcctcagtatcaatatgaaatgatggatgctcaagtattatta
acaacttctatgcctgatcaagcagtgggagggtctgcatga

DBGET integrated database retrieval system