KEGG   Aliivibrio salmonicida: VSAL_I1174Help
Entry
VSAL_I1174        CDS       T00782                                 

Gene name
vasS-1
Definition
(GenBank) putative type VI secretion protein VasS-1
  KO
K11897  type VI secretion system protein ImpF
Organism
vsa  Aliivibrio salmonicida
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vsa02044]
    VSAL_I1174 (vasS-1)
Secretion system [BR:vsa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VSAL_I1174 (vasS-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25 Brucella_OMP2 Elong_Iki1
Motif
Other DBs
NCBI-ProteinID: CAQ78859
UniProt: B6EJJ5
Position
1:1278288..1278710
Genome map
AA seq 140 aa AA seqDB search
MSLMAKLTQSWTNDVDAVRDAIIDNICDLISSRAPIWPTLESSDELADTIAYSGLRNMTR
AQSKSNSDVIIVDITHLIRCYEPRLIDVLIEVEEKEKSKNQLQFRISATMLSDQGEEAIV
LNSFLDLSRNILDVRKSNFV
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaatggcgaagttaactcaatcttggactaatgatgtggatgcggtgcgtgat
gcgattattgataatatttgtgatcttatttcaagtcgagctccaatttggccaacgtta
gaatcatcagatgaattggctgatacgattgcctattctggattacgtaatatgactcgt
gcacagagtaaatcgaatagtgatgtgattattgttgatattactcatttgatccgttgc
tatgaacctaggttaattgatgtcttgatagaagtagaagaaaaagaaaaatcaaaaaat
caattacagtttcgtatttctgcgacgatgttatctgaccaaggcgaagaagccattgta
ttgaattcctttttggatctaagtcgaaacatattggatgtaaggaaatcaaattttgtc
tga

DBGET integrated database retrieval system