KEGG   Aliivibrio salmonicida: VSAL_I1182Help
Entry
VSAL_I1182        CDS       T00782                                 

Gene name
vasF-1
Definition
(GenBank) putative type VI secretion protein VasF-1
  KO
K11892  type VI secretion system protein ImpK
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VSAL_I1182 (vasF-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vsa02044]
    VSAL_I1182 (vasF-1)
Secretion system [BR:vsa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VSAL_I1182 (vasF-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU SPOR ThiD2
Motif
Other DBs
NCBI-ProteinID: CAQ78867
UniProt: B6EJK3
Position
1:1287108..1288232
Genome map
AA seq 374 aa AA seqDB search
MSELFNDEATIELRHTKEKIPAKKKNAELKDIDLLGAEWLIDNLSVYNSSLLNSATELFA
ILVTLSRQGEPRDINRFRQRLLDEISVFRQRGAHLEYHPSIIEKSCFVLCAAFDEAILYT
QWGESARWENHSLLSKVFSQRNGGEAFFTLLDKASQQPAKLVDFLELQYVLLMLGFKGRF
RHDNENVLHEIQSNVYSIIRHYRSESVLPVPKIPELIEGKQPWLMLSMSKTLVIAFFITI
IVYGASEYWYFNRSQPILAQFNAINTSSVGKKNNKELINISSGSDIGKIVDNRKQELKET
LQWEVVLAAFTRSLDAVRLVSELQQAGYEPFTRETDHGVELYIRAGDNLSVIRKLKNELN
IRFDLNATIKRAQI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaattatttaatgacgaagcgacaatagaacttcgtcatactaaagaaaaaata
ccggcaaagaaaaaaaatgcagaacttaaggatatagatctcttaggtgcagagtggttg
attgataacctctctgtttataatagctcgttattgaattctgcaactgagctatttgca
attttggtcactttatctcgtcaaggcgaaccgcgagatataaatcgatttaggcaacgt
ttgttggatgaaatatctgtatttcgccaacgtggagcacatcttgaatatcacccaagt
attatagaaaaaagttgttttgtattatgtgccgcttttgatgaagccattctttatacg
caatggggggaaagtgctcgttgggaaaaccattcattattaagtaaggttttttctcaa
cgtaacgggggcgaagctttttttacattattggataaagcgagccaacagccagcaaaa
ttagtagattttttagaattgcaatacgttttacttatgttgggatttaaaggacgtttc
cgtcacgataatgaaaatgttttacatgaaattcaatcaaatgtgtattccattattcgt
cattatcgcagtgaatctgtattacctgtaccaaaaataccagaactaattgaaggtaaa
caaccatggttaatgctaagtatgtcgaaaacattagtgattgctttctttatcacaatc
atagtttatggtgcgtcagagtattggtattttaatcgtagccagccaattcttgcacaa
tttaatgctatcaatacgtctagtgtaggtaagaaaaataacaaagaattaattaatatt
agttcgggttcagatattgggaaaatagttgataatagaaaacaagaacttaaagaaact
ctgcaatgggaagttgtgcttgctgcatttactcgttcattagatgctgtgcggttggtg
tcagaattacagcaagcggggtatgaaccattcacacgagaaacagaccatggtgtcgag
ctttatattagagctggagataatttatcggttatacgaaagctcaaaaatgaattaaat
attcgctttgacttgaatgctacgattaagagagcgcagatataa

DBGET integrated database retrieval system