KEGG   Aliivibrio salmonicida: VSAL_I1202
Entry
VSAL_I1202        CDS       T00782                                 

Gene name
hcp
Definition
(GenBank) secreted protein Hcp-1 (haemolysin co-regulated protein)
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VSAL_I1202 (hcp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vsa02044]
    VSAL_I1202 (hcp)
Secretion system [BR:vsa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VSAL_I1202 (hcp)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CAQ78887
UniProt: B6EJM3
Position
1:1311319..1311840
AA seq 173 aa
MPTPAYMSIKGEVQGDITKDAYSADSIGNTWQEAHIDEFLVQELDHVLTVPRDPQSGQPT
GQRVHRPVIVTKQQDRCSPLLFNSLVSGEKLPECSINFYRTSISGKQEHYYTIKLIDALL
VDMQTRMAHCQDAATSDRVTEEVLKFTYRAIEVTHETCGTAGNDDWRAPREAG
NT seq 522 nt   +upstreamnt  +downstreamnt
atgccaactccagcgtatatgtcaataaaaggcgaagttcagggtgacatcactaaagat
gcgtattcagcagattcaatagggaatacgtggcaagaagcacacattgatgagtttctt
gttcaagaacttgatcatgtattaacggttccacgtgatcctcaaagtggccagccaaca
ggtcaacgagttcaccgtcctgtgattgtaactaaacaacaagaccgctgttctccattg
ttgtttaactcattagtttcaggtgaaaaattaccagagtgcagtatcaacttctaccgt
acgtctatttctggtaagcaagagcactattacacaatcaaattgattgatgcactgctt
gtagatatgcaaactcgcatggctcattgtcaagatgctgcaacgtcagatcgtgtaaca
gaagaagtgcttaagtttacttaccgtgcaattgaagtgactcacgaaacgtgtggcacg
gcaggtaatgatgattggcgcgcaccacgcgaagcgggttaa

DBGET integrated database retrieval system