KEGG   Aliivibrio salmonicida: VSAL_I2640Help
Entry
VSAL_I2640        CDS       T00782                                 

Gene name
ftsZ
Definition
(GenBank) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
vsa  Aliivibrio salmonicida
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vsa03036]
    VSAL_I2640 (ftsZ)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:vsa04812]
    VSAL_I2640 (ftsZ)
   02048 Prokaryotic Defense System [BR:vsa02048]
    VSAL_I2640 (ftsZ)
Chromosome and associated proteins [BR:vsa03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    VSAL_I2640 (ftsZ)
Cytoskeleton proteins [BR:vsa04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   VSAL_I2640 (ftsZ)
Prokaryotic defense system [BR:vsa02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    VSAL_I2640 (ftsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: CAQ80324
UniProt: B6ELH1
Position
1:complement(2856272..2857507)
Genome map
AA seq 411 aa AA seqDB search
MFEPMMEMSDDAVIKVVGVGGGGGNAIEHMVRESIEGVEFISVNTDAQALRKTSVNTVIQ
IGGDITKGLGAGANPQVGRDAALEDREAIKEALMGADMVFIAAGMGGGTGTGAAPIIAEV
ARELNILTVAVVTKPFSFEGRKRLAFAEQGIEELSKHVDSLITIPNEKLLKVLGRGITLL
EAFAKANDVLRNAVQGIAELITRPGMINVDFADVRTVMSEMGHAMMGSGVAVGEERAEEA
AEMAISSPLLEDIDLAGARGVLVNITAGLDMRLDEFETVGNTVKAFASDNATVVIGTSLD
PDMTDEIRVTVVATGIGTEKKPEITLVTNKATSAPAQQTPAAQVKPKAEAPVVEPVVEKA
AQNVQVTKPASQQTTSTSPAAGVQNAGAAQAKPDQKEDYLDIPAFLRRQAD
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagccgatgatggaaatgtccgacgacgcagtaattaaagttgttggtgtaggt
ggcggtggcggtaatgccattgaacacatggtacgtgagtcaattgaaggcgttgagttt
atcagtgtaaatactgatgctcaggcacttcgtaagacgagtgtaaacacagttattcag
attggtggagacatcacgaaaggcttaggtgcaggtgcaaacccacaagtaggccgtgat
gcagctctagaagatcgagaagcgattaaagaagctctgatgggtgccgatatggtattt
attgcagcgggcatgggtggcggtacaggtactggtgcggctccaattattgctgaagtt
gcaagagagctgaacatcttgaccgttgctgtcgtaacaaagccatttagctttgaaggt
cgtaagcgtcttgcttttgctgagcaaggaatcgaagaattatcaaaacatgttgattca
ttaattacgattccaaatgaaaaattacttaaagtacttggtcgtggtattacgttatta
gaagcgtttgcgaaagcaaatgatgttcttcgtaatgcagttcaaggtattgctgagtta
attactcgtccaggtatgatcaacgtcgatttcgcggatgttcgtacggtaatgtctgaa
atgggacatgcaatgatgggtagcggcgtcgccgttggtgaagaaagagcagaagaagcg
gctgagatggctatctcaagcccattgcttgaagatatcgatttggctggtgctcgtggt
gttcttgttaacattactgctggtcttgatatgcgccttgacgaatttgaaaccgttggt
aacacagtaaaagcatttgcttcagataatgcgacagtcgttattggtacgtctttagac
cctgatatgactgatgaaattcgagttactgtagttgcgactggtatcggcactgaaaaa
aagcctgaaattacattagtaacaaataaagcaacatcagcgccagcacaacaaacacca
gcggctcaagttaagccaaaggcagaagctcccgttgttgaaccggttgttgagaaagcg
gcacaaaatgtgcaagtaactaaaccagcatcacagcaaacaacatcgacctctccggcg
gctggtgttcaaaatgcaggtgcagcacaagctaaaccagatcaaaaagaagattattta
gatatcccggcgttcttacgtcgtcaagctgactaa

DBGET integrated database retrieval system