KEGG   Aliivibrio salmonicida: VSAL_II0404Help
Entry
VSAL_II0404       CDS       T00782                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00620  Pyruvate metabolism
vsa00630  Glyoxylate and dicarboxylate metabolism
vsa01100  Metabolic pathways
vsa01110  Biosynthesis of secondary metabolites
vsa01120  Microbial metabolism in diverse environments
vsa01200  Carbon metabolism
Module
vsa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VSAL_II0404
   00630 Glyoxylate and dicarboxylate metabolism
    VSAL_II0404
Enzymes [BR:vsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VSAL_II0404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAQ81158
UniProt: B6ER28
Position
2:complement(454879..455442)
Genome map
AA seq 187 aa AA seqDB search
MAITTVNTTNNEQKETPFMAEAVFAVEEMNSNTNKDKQHEIKQLLDTLFPLAKGSHQDVT
NYLLDYHHLVVFFKDGGCSGLLNPGKFVAFTGHRSSPDRILLKDNSGSHVEIVFGHHESG
KNKLVTIDDIEMETCTTFSQDFSLAAMRYWISLLKRDDKSQPKARQEDKDYTAKNGGDYQ
LTSCFSL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggctatcacaacagtaaacacgacgaataatgaacaaaaagaaactccgtttatggct
gaagccgtctttgccgtagaggaaatgaactcaaacacaaataaagataagcagcatgaa
ataaaacaattactcgatacgttgtttccattagcgaaaggatcacaccaagatgtgaca
aattacttattagactatcatcaccttgttgtgttttttaaagatgggggatgcagcgga
ttacttaacccagggaaatttgttgcatttaccggccaccgctcatcacctgatagaatt
ctattaaaagacaacagtggcagtcatgtagaaattgtttttggtcatcatgaatctggg
aaaaacaaactggtgacaattgatgatattgaaatggaaacctgcactacgtttagtcaa
gatttcagtttagcggcgatgcgttattggatcagtttattaaagcgagacgacaaatca
caaccaaaagcacgccaagaagacaaagattatacggctaaaaatgggggcgattaccaa
ctgaccagttgcttcagtttataa

DBGET integrated database retrieval system