KEGG   Aliivibrio salmonicida: VSAL_II0582Help
Entry
VSAL_II0582       CDS       T00782                                 

Gene name
gly
Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00260  Glycine, serine and threonine metabolism
vsa01100  Metabolic pathways
vsa01110  Biosynthesis of secondary metabolites
vsa01120  Microbial metabolism in diverse environments
vsa01130  Biosynthesis of antibiotics
vsa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VSAL_II0582 (gly)
Enzymes [BR:vsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     VSAL_II0582 (gly)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP YlmH_RBD
Motif
Other DBs
NCBI-ProteinID: CAQ81336
UniProt: B6ERK3
Position
2:complement(638108..639208)
Genome map
AA seq 366 aa AA seqDB search
MDCYIYKHYYSVVEIYNNGKKPSLVINGNQGRSMIDFRSDTVTRPTQAMRDAMANALVGD
DVYGDDPTVNELEQWTAERHGFEAALFTSSGTQANLLGLMTHCERGDEYLCGQQAHNYKY
EAGGAAVLGSIQPQPIENNPDGSLCFTKLAAAIKADDFHFARTKLLSLENTINGKVLPLS
YLAQAREFVNKHNLALHLDGARVYNAATALNVDIKEIAQHFDSMTICLSKGLSAPIGSLL
LGPKEYIQKARRIRKMLGGGMRQAGILAAAGKLALTEQVPQLAIDHSNAKYLAKQLNTVD
GFSVNVEHIQTNIVFAKLDANVDIHHIEQKAQQQDILISAGNPIRFVTHKDISKDDIDTF
IAFLNA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggattgttacatttataaacactattatagcgttgttgaaatatataataatggcaag
aaaccctctctagtaataaatggtaatcaaggaagaagcatgattgattttcgctctgac
accgtaacccgtccaactcaagctatgcgtgatgcaatggctaatgcccttgtcggtgat
gacgtttatggtgatgacccgactgtaaatgagttagaacaatggaccgcagagcgtcat
ggatttgaagcggcattatttacctcttcaggtactcaagctaatttgctcggcttaatg
acgcattgtgaacgtggtgatgagtatttatgtgggcaacaagcgcataactacaaatac
gaagctggcggagcggcggttttaggttcaatccaacctcaaccgattgagaataatcca
gacggctcgttgtgttttacaaaactagcagctgcgattaaagccgatgattttcatttt
gctcgtacaaaattgttaagtcttgaaaatacaattaatgggaaagtgttgccattatct
tatcttgctcaagctcgtgagtttgttaataagcataatttagcgcttcacttagacggc
gctcgtgtttataacgcagcaacagcacttaatgttgatattaaagaaatcgcacagcat
tttgatagcatgactatctgtttatcaaaagggttatcggcacccattggttctttgttg
ttaggcccgaaagagtatatccagaaagcacgccgcattagaaaaatgttaggtggtggc
atgcgtcaagccggtatccttgccgccgcaggtaaattggcgttaactgagcaagttcct
cagttagctatagaccacagcaacgcaaaataccttgctaaacaattgaatacggtggat
ggtttttctgtcaatgttgaacatattcaaacaaatatcgtatttgcaaaattagacgcg
aacgttgatatacaccatattgaacaaaaagctcaacagcaagatatcttaatctctgcg
ggtaaccctatccgttttgtgacacataaagacatttcaaaagatgatatcgatacgttt
attgcctttttaaacgcataa

DBGET integrated database retrieval system