KEGG   Aliivibrio salmonicida: VSAL_II0859Help
Entry
VSAL_II0859       CDS       T00782                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00780  Biotin metabolism
vsa01100  Metabolic pathways
Module
vsa_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    VSAL_II0859 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vsa01007]
    VSAL_II0859 (bioF)
Enzymes [BR:vsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     VSAL_II0859 (bioF)
Amino acid related enzymes [BR:vsa01007]
 Aminotransferase (transaminase)
  Class II
   VSAL_II0859 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 Aminotran_3 Beta_elim_lyase SHMT OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: CAQ81613
UniProt: B6ESC6
Position
2:complement(942950..944101)
Genome map
AA seq 383 aa AA seqDB search
MKQAFSERISSALTLRKQAGLTRARTVIEQGNQSRLSVDGKSYLNFSGNDYLGLAGSQEL
TQAWQQGLSLYGSGSGASPLVTGYSKPHADLESQLAEWLGFDCAVLFNSGFSANQAVLFS
LLEKGDQVVQDKLNHASLMEAGILSPASMKRFKHNDVAHLDKLLKASICNPSLVVTEGVF
SMDGDLSPLSELSRVTKENNAWFMVDDAHGCGVLGSHGRGCCDLYQITPDILVVTFGKAF
GLSGAAVLCNVECGDYLSQFARHHVYSTAMPPAQAHALSHALSMIQQQEWRRKKLDELSQ
QFESELRLCVGVITTQTPIKPIIIGDSETAIALSDSLKEKGMWTTAIRPPTVPLGTARLR
VTLSANHSEKDIKLLTQAITELR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagcgtttagtgaacgtattagctctgcacttactttgcgcaagcaagcaggg
ctaactcgtgccagaacggttattgaacaaggtaatcaatccagattaagtgtcgatggt
aaatcgtaccttaatttttcagggaatgattatcttggcttagccggcagtcaagaatta
acacaagcatggcaacagggcctctctttatatggcagtggcagcggtgcttcaccttta
gttactggctattcaaaacctcacgctgatcttgaatcacagttggctgaatggttaggt
tttgattgtgctgtgttatttaattcgggctttagtgccaaccaagcggttctgttttca
ttattagaaaaaggcgatcaagtcgttcaagataaattgaatcatgcctcgttgatggaa
gcaggaattttatcacctgcgagcatgaagcgttttaaacataatgatgtagcacactta
gataaattactgaaggcatcaatttgtaatccttctttggtggtaacggaaggcgttttc
agtatggacggtgatctttcccctttatctgagttatcaagagtaacgaaagaaaataac
gcttggttcatggtggatgatgctcatgggtgcggggtgctaggaagtcatggccgtgga
tgttgcgatctttatcaaattacgcctgatattctcgttgttacttttggtaaagcgttt
ggtctgtctggtgctgcggtattgtgcaacgttgagtgtggcgattatttatctcagttt
gctcgtcatcatgtgtattcaaccgcgatgccaccagcacaagcacatgcgttatcacat
gcgttatcgatgatccaacaacaagaatggcgtcgtaaaaaactagacgagttaagtcaa
caatttgaatcagagttaagattatgtgttggtgttattacaacgcaaacaccaatcaag
ccgatcattattggtgacagcgaaaccgcgatagccttatctgattcattaaaagaaaag
ggaatgtggactaccgcgattcgtccccccacagtcccgttgggtactgctcgtttacga
gtgacgttaagtgcaaaccattcagagaaagacattaaattgcttactcaagcgataaca
gaattaaggtga

DBGET integrated database retrieval system