KEGG   Aliivibrio salmonicida: VSAL_p840_14Help
Entry
VSAL_p840_14      CDS       T00782                                 

Gene name
traF
Definition
(GenBank) conjugative transfer protein TraF
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
vsa  Aliivibrio salmonicida
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vsa02044]
    VSAL_p840_14 (traF)
Secretion system [BR:vsa02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VSAL_p840_14 (traF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraF T2SSM DUF5051
Motif
Other DBs
NCBI-ProteinID: CAQ81873
UniProt: B6ESY5
Position
pVSAL840:11549..12292
Genome map
AA seq 247 aa AA seqDB search
MNRCIAMIAFFVSTGVLAAPNGWRWYNEPTQDAKAPAPITKPNTVTRTLSARAQLTWFKE
QHQEAQAAATIDPSNNQKVEKAMRLNQYVSNQSSQFGMTFKEVLLSHPELSYTKDRPVEQ
AARSTYLELEREKKVHTIKQMAAEGWGFFFVYEGKDTLSQTLAPSIQQFATTHGIEVLGI
SKDGTTLESIRENRMDDNTLNVAYLPALLLVNPNTKTIKPLAYGFISQDQLLGRFYNVAT
HYNSPDF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgatgcatcgcaatgatcgcctttttcgtcagtaccggtgtattggctgcgcct
aacggatggcgatggtataacgagccaacccaagacgctaaggcaccggcgcccatcaca
aagccaaacacggtgactcgcaccttaagtgcccgcgcacaattaacgtggtttaaagag
caacaccaagaagcgcaagccgccgccacgattgacccaagcaacaaccaaaaagtagaa
aaagcgatgcgactcaatcaatacgtgtccaatcaatcctctcaatttggcatgaccttt
aaagaagtcttattgagtcaccctgagctgtcttacaccaaagacagacccgtagagcaa
gcggcacgaagcacgtatttagagctggagcgcgagaaaaaagtgcacaccattaaacaa
atggccgctgagggatggggatttttctttgtgtatgaaggcaaagacacgttaagccaa
accctcgcgccaagcattcagcaatttgcgaccacccatggcattgaggtgctagggata
agcaaagacggcaccacactagagagcatcagagaaaacagaatggacgacaacaccctg
aacgtggcgtatttgcccgcgctgctgcttgtgaaccccaacacaaaaaccattaagccg
ttggcgtatggatttatttcacaagaccaattattggggcgtttttacaacgtggccacc
cattacaacagccctgatttttaa

DBGET integrated database retrieval system