KEGG   Vibrio scophthalmi: VSVS12_03566Help
Entry
VSVS12_03566      CDS       T04650                                 

Gene name
gmpP
Definition
(GenBank) Mannose-1-phosphate guanylyltransferase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
vsc  Vibrio scophthalmi
Pathway
vsc00051  Fructose and mannose metabolism
vsc00520  Amino sugar and nucleotide sugar metabolism
vsc01100  Metabolic pathways
vsc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    VSVS12_03566 (gmpP)
   00520 Amino sugar and nucleotide sugar metabolism
    VSVS12_03566 (gmpP)
Enzymes [BR:vsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     VSVS12_03566 (gmpP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep DUF4954 IspD
Motif
Other DBs
NCBI-ProteinID: ANS87275
UniProt: A0A1B1NU62
Position
2:580036..581157
Genome map
AA seq 373 aa AA seqDB search
MKGMILAAGKGTRVRPITQSIPKPMIPILGKPVMESMIELFAQHNISKIMINTSHLAEVI
EGYFGDGHHFGVQLSYSYEGELKEGEYRSKALGSAGGMKKIQEFSGFFDETFVVVCGDAW
IDLDLNEAVQKHKKKGGIATIISKNVLDDEVEKYGVVVTDSRGQVTSFQEKPAKEEALSN
QINTGIYIFEPAIFDYIPHGEEFDIGSDLFPLLVEQHVPFYSVDMPFQWLDVGNISDIWG
VTRDILDGKVPGYRIPGTQVKAGVWLGINTVVDLDKCNIVPPAVIGSGCKISDEAHIIGP
ALIGANCILEADCQVQESLIFDNIHVHKGTQVKQQTIFGNYCIGHDGKPCEDLQWNHLRS
GPKDRVSDAFKSI
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggatgattcttgctgcagggaagggcacacgtgtgcgtcctattactcaatcg
ataccaaaaccgatgatcccgattttaggaaaaccggtaatggaatcgatgattgagcta
tttgcccagcacaacatcagtaaaatcatgatcaataccagccatcttgcggaggtaatt
gaaggctactttggtgatggtcaccactttggcgtccaactttcgtattcatacgaaggc
gagttaaaagagggagaatatcgcagtaaagcgctcggttctgctgggggaatgaaaaag
atccaagagttttccggctttttcgatgaaacatttgtcgtggtatgcggagatgcatgg
atcgatcttgacttaaatgaagcggtacaaaaacacaaaaagaagggtggtatcgcgacc
attattagtaaaaacgttctcgatgacgaagtggaaaaatacggtgtagtggtgacggat
agccgcggtcaagtcaccagtttccaagagaaaccagccaaagaagaagcgctttctaat
caaatcaatactgggatttatatctttgaaccagcgatattcgactatatcccccatgga
gaagagttcgatattggtagtgatctctttcctcttttggttgagcagcatgtaccattt
tattcggtcgatatgcctttccaatggttggatgttggcaatattagcgatatttggggc
gtcacccgcgacattctcgatggcaaagttccaggttatcgcattccgggtacccaagtg
aaagcgggtgtttggttaggtattaataccgtcgttgatttagataaatgcaacatagtc
ccaccggctgtgattggcagtggttgcaaaatctcagacgaggcacacatcattgggccg
gcgttaattggagcgaactgcatccttgaagctgattgtcaggttcaagagtcgctgatt
ttcgacaatattcatgttcataaaggtacccaagtgaaacaacaaaccatctttggcaat
tactgtattggccatgatggtaagccatgtgaagacttgcagtggaaccatctgcgctct
ggaccaaaagatcgcgtatcggatgcattcaaatcgatttaa

DBGET integrated database retrieval system