KEGG   Vibrio shilonii: BSZ05_14160Help
Entry
BSZ05_14160       CDS       T04936                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vsh  Vibrio shilonii
Pathway
vsh00071  Fatty acid degradation
vsh00072  Synthesis and degradation of ketone bodies
vsh00280  Valine, leucine and isoleucine degradation
vsh00310  Lysine degradation
vsh00362  Benzoate degradation
vsh00380  Tryptophan metabolism
vsh00620  Pyruvate metabolism
vsh00630  Glyoxylate and dicarboxylate metabolism
vsh00640  Propanoate metabolism
vsh00650  Butanoate metabolism
vsh00900  Terpenoid backbone biosynthesis
vsh01100  Metabolic pathways
vsh01110  Biosynthesis of secondary metabolites
vsh01120  Microbial metabolism in diverse environments
vsh01130  Biosynthesis of antibiotics
vsh01200  Carbon metabolism
vsh01212  Fatty acid metabolism
vsh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSZ05_14160
   00630 Glyoxylate and dicarboxylate metabolism
    BSZ05_14160
   00640 Propanoate metabolism
    BSZ05_14160
   00650 Butanoate metabolism
    BSZ05_14160
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSZ05_14160
   00072 Synthesis and degradation of ketone bodies
    BSZ05_14160
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSZ05_14160
   00310 Lysine degradation
    BSZ05_14160
   00380 Tryptophan metabolism
    BSZ05_14160
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSZ05_14160
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSZ05_14160
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSZ05_14160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vsh04147]
    BSZ05_14160
Enzymes [BR:vsh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSZ05_14160
Exosome [BR:vsh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSZ05_14160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ASI90838
UniProt: A0A2C9PDR2
Position
1:3019459..3020670
Genome map
AA seq 403 aa AA seqDB search
MERVFIVAAKRSAIGSFGGTLQNVTAGKLASEVITGAVDACGITVNDIDEVIVGNVVSAN
QGMGVGRQASIYAGIPAEVPAYTLNMVCGSGMKTLMDAASHIKSGEAEVVVAAGVEVMSQ
IPFAMPASARSGHKMGDITAKDLLVSDGLTDVFNAYHMGVTAENIAKEVDISRDDQDAYA
LQSQQKAAAAIEAGKFVDEIQPIEVKIRRQSVEFLTDEYPKLDATMQGLSKLRPAFDREG
TVTAGNASGINDGASALVVASESAVERLGLTPLCEVVNCAQTGIDPKVMGLGPVQAVTQV
LSKAELTIENVDVFELNEAFAAQALGVIRNLASQHGVSAESILQKANPNGGAIALGHPLG
ASGNRIIVTLIHEMLREQKNIGVASLCVGGGMGTAVLLKNCQS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagtttttattgttgcagcaaagcgttcagcaatcggtagttttggtggcacc
ttacagaacgttacggctggaaaacttgcatcggaagtgattactggagcggtcgatgcc
tgcggtataaccgttaacgatatagatgaagtgattgtcggtaacgttgtgagtgcaaat
caaggcatgggagtaggacgacaagcttctatctatgcaggtattccagcggaagttcca
gcttatacgctaaatatggtatgtggcagcggaatgaaaacgctcatggatgccgcatca
catatcaaatcaggcgaggcagaagttgttgtcgctgctggtgttgaggttatgtcgcaa
atcccgtttgctatgccagcatcggcacgttcaggtcacaaaatgggggatatcaccgca
aaggatctgctcgtttcagatggactcacagatgtctttaacgcttaccatatgggtgtg
acagctgagaacatcgctaaggaagtcgatatttctcgtgacgaccaagatgcgtatgcc
ctacaaagccagcaaaaagcggcggcagcgattgaagcaggaaagtttgtagacgaaatt
caacccattgaggtgaaaattagacgtcaaagcgttgaatttttgaccgatgaataccca
aaactagacgcgaccatgcaaggcttatctaagttaaggcctgcgtttgatagagaaggt
acggtgacggcgggtaatgcgtcgggcattaatgatggtgctagcgctttggttgttgct
tccgagtcggcggttgaacgcctggggttgacgccactatgcgaagtcgttaactgcgct
caaactggcattgacccgaaagttatgggtcttggcccggttcaagcggtgactcaagtg
cttagtaaagccgagttgactatagaaaacgtggatgtgtttgagcttaacgaagcgttt
gcggcgcaagcgttaggcgttatacgcaacttagcgtcgcagcatggtgtgtctgcagag
tctattttgcagaaagctaatccaaatggtggtgctattgccttaggacatccattagga
gcatctggtaatagaatcattgtcactctcattcatgaaatgttacgcgaacaaaaaaat
atcggcgttgcatctttatgtgtaggtggtggtatgggaacagcagtacttttgaaaaac
tgccagtcttaa

DBGET integrated database retrieval system