KEGG   Vibrio mediterranei: BSZ05_17150Help
Entry
BSZ05_17150       CDS       T04936                                 

Definition
(GenBank) hypothetical protein
  KO
K19243  NAD+ dependent glucose-6-phosphate dehydrogenase [EC:1.1.1.388]
Organism
vsh  Vibrio mediterranei
Pathway
vsh00030  Pentose phosphate pathway
vsh01100  Metabolic pathways
vsh01110  Biosynthesis of secondary metabolites
vsh01120  Microbial metabolism in diverse environments
vsh01130  Biosynthesis of antibiotics
vsh01200  Carbon metabolism
Module
vsh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
vsh_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:vsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSZ05_17150
Enzymes [BR:vsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.388  glucose-6-phosphate dehydrogenase (NAD+)
     BSZ05_17150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 NAD_binding_10 DapB_N
Motif
Other DBs
NCBI-ProteinID: ASI91581
UniProt: A0A241T8M4
Position
2:complement(70623..71441)
Genome map
AA seq 272 aa AA seqDB search
MKKIVITGATGHLGNKLYEYLSQNDQLDVWGLDIRPSDNPQIIVGDITQYDDAWADVFAD
CYGVVHLAADRDNQCNWDSAIPNNIDATINVFQAAAKHGVKRFVFASSNWVVGGYRFIDA
RLTPDILPNPVNPYGVTKLVGERMGNFFSEQYDMSVVSARIGWTQWTHDNQPGAHMEMGR
WGQLMWLSDRDYLHGMERSLFAEVEGHVVVNLMSNNKGMKWCLESSAQQIGYQPQDSATA
ELPITIRTKECIAWLGQRFIPSLGKWVNKPSF
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgtgataacaggtgcgacaggtcatctgggaaacaagctatatgagtac
ttatcgcaaaacgatcaactggatgtgtggggtcttgatataagaccaagtgataatccc
caaattattgttggtgacattacccaatatgatgacgcttgggcggatgtctttgcagat
tgttatggcgtagtccatttagctgcagaccgagataatcaatgtaattgggactctgca
attcctaataatatcgatgcgactatcaatgtttttcaagcagctgcaaaacatggcgtg
aaacgttttgtatttgccagttccaattgggttgtaggtggctatcgatttatcgatgct
cgccttacacctgacatcttacctaatcctgtaaacccttatggcgtaaccaaattagtt
ggtgagcgtatggggaatttctttagtgagcaatatgacatgagtgtggtcagcgcgaga
attggctggactcaatggactcatgataaccagcctggtgcgcacatggaaatggggcgt
tgggggcaactaatgtggctgagtgaccgagactatctgcatggaatggagcgctcgctt
tttgccgaagttgaaggtcatgtcgttgttaacctgatgtcaaacaacaaaggcatgaaa
tggtgtcttgaaagttcggctcaacagatcggttaccaacctcaggacagtgcaacagct
gaattacctataacgataagaactaaagagtgcattgcttggctaggacaaaggttcatt
ccatctctagggaaatgggtaaacaaaccaagcttttaa

DBGET integrated database retrieval system