KEGG   Vibrio atlanticus: VS_2899
Entry
VS_2899           CDS       T00812                                 
Name
(GenBank) HTH-type transcriptional repressor cytR
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
vsp  Vibrio atlanticus
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vsp03000]
    VS_2899
Transcription factors [BR:vsp03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    VS_2899
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_38 HTH_Tnp_ISL3 ClpB_D2-small HTH_Crp_2
Other DBs
NCBI-ProteinID: CAV20196
UniProt: B7VLM4
Position
1:3053866..3054870
AA seq 334 aa
MATMKDVAQLAGVSTATVSRALMNPEKVSVSTRKRVETAVLEAGYSPNTLARNLRRNESK
TIITIVPDICDPYFAEIIRGIEDAAVENDYLVLLGDSGQQKKRESSFVNLVFTKQADGML
LLGTDHPFDVSKPEQKNLPPMVMACEFAPELELPTVHIDNLTSAFEAVNYLAQLGHKRIA
QISGPISATLCKFRQQGYQQALRRAGVSMNPAYSTVGDFTFEAGAQAVRQLLALPEQPTA
IFCHNDAMAIGAIQEAKKLGLRVPQDLSIVGFDDIQFAQYCDPPLTTISQPRYEIGRQAM
LMMLDVLKGNDVQAGSRLLEAKLVVRGSTAPPRI
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggcgacaatgaaggatgttgcccagctagcaggcgtttcaacagccacggtatcacgt
gcattgatgaaccctgaaaaagtctcggtttctactcgtaagcgagtggagacagcagta
cttgaagctggatactcacccaatacattagctagaaacttacgtcgcaacgaatcaaaa
accatcatcactattgttcctgatatctgtgacccgtatttcgcagagatcattcgtggt
atcgaagatgccgcagtagaaaatgactacctcgttttactgggtgatagcggccaacag
aagaagcgtgagtcttcatttgttaacttagtattcaccaaacaagctgacggcatgcta
ctacttggcaccgaccacccgtttgatgtcagtaagcctgaacaaaaaaatttaccgccg
atggtgatggcgtgtgagtttgcccctgagcttgaactccctaccgtacacatcgataac
ctgacctcagcatttgaagcggtgaactacctagctcagttaggccataaacgtatcgct
caaatctcagggcccatatcggcaacgctgtgtaaattccgccaacaaggttaccaacaa
gcgctacgtcgtgcaggagtatcaatgaatcctgcctacagcactgtcggtgactttacc
tttgaagcgggcgctcaagctgttcgtcaattactcgctcttcctgaacaacctacagcg
atcttctgtcataacgatgcgatggccatcggcgcgattcaagaagcgaaaaaattaggc
ttacgcgttcctcaagacctatcgattgtcggctttgatgacatccaattcgctcaatac
tgcgatccaccgctaaccactatttctcagcctcgttatgagattggacgccaagcaatg
ttgatgatgctcgacgtacttaaaggcaacgatgtgcaagcggggtcgcgcctgcttgaa
gccaaattagtcgttcgaggtagtacagcgccgcctcgaatctaa

DBGET integrated database retrieval system