KEGG   Vibrio tasmaniensis: VS_0157Help
Entry
VS_0157           CDS       T00812                                 

Definition
(GenBank) Osmolarity sensor protein envZ
  KO
K07638  two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC:2.7.13.3]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VS_0157
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vsp01001]
    VS_0157
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vsp02022]
    VS_0157
Enzymes [BR:vsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     VS_0157
Protein kinases [BR:vsp01001]
 Histidine kinases
  OmpR family
   VS_0157
Two-component system [BR:vsp02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   VS_0157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_3 HATPase_c_2 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: CAV17189
UniProt: B7VHH7
Position
1:149898..151193
Genome map
AA seq 431 aa AA seqDB search
MRIRSSFTQSIVLFLTLLVASQIFSYYAVFNYALMPSLQQFNKILAHELNLVLDQGSDIE
IDAPLRQRVLEQLGVTVHAKDSEASGEYYHAVAIDLMSEEMTKELGSETEVRLVLGKESY
VLWMDIAQLPNSLIRIPLSELQEEDFAPLFRNSLIMALLIVAGGWLFIRLQNRPLIALEK
AAQGVGRGDIPPPLPVQGAQEIRSVTRAFNQMSKGIQELEEDRALLMAGISHDLRTPLTR
IRLATEMMSPEDSYLAEGIISDTEECNEIISQFMDYLKPVDRDSFQAVFVDDIAREVSSS
EGGYEVQIETDIPETMKPALGNPIAMKRAVSNLVVNALRYGNGWVKVSTGMTADNKLAWV
TVEDNGPGIPQDQIGKLFEPFTRGDTARGSEGTGLGLAIVKRIVSQHQGAVVVNNRSEGG
LKAQISFPVKP
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatacgtagctcctttactcagtcgatagtgctcttcttaaccctgttggttgcc
agccaaattttttcgtattacgcggtgttcaattatgcattgatgccgagtttgcagcag
tttaataagattttggctcacgaactcaacctagtattggaccaaggcagtgatatcgag
attgatgcgccactgcgtcagcgtgtacttgagcagctcggggttacggttcatgcaaag
gacagtgaagcgtcgggcgagtactaccatgcggtcgcgatagacctgatgagtgaggag
atgaccaaagagttgggctctgagaccgaagtgcgattggttttgggcaaagaaagttac
gtgttgtggatggacattgctcagttgcctaactctttgattcgtattcccctgtctgag
ctgcaagaagaagactttgcgcctctatttcgtaacagtctgatcatggcgttgttgatt
gttgctggtgggtggctgtttatccgcttgcaaaatcggccgttgatagccctagagaaa
gccgcgcaaggtgttgggcgaggtgatattccaccgcccttaccagtacaaggtgcacaa
gagattcgctcggtaactcgagcctttaatcagatgtcgaaaggcattcaagaactcgaa
gaagatagagccctactaatggcgggtatcagccatgatctgcgtacaccactcacgcgt
attcgcttggcgactgagatgatgtcgccagaagatagctatctagcggaagggatcatc
agtgatactgaagagtgcaatgagatcatcagtcagtttatggattacctaaagcctgtg
gaccgagactcattccaggcggtatttgtcgatgatattgcgcgcgaggtctctagctct
gaaggaggctatgaggttcagattgaaaccgatattccagaaaccatgaaacctgctttg
ggtaacccgatcgcgatgaagcgtgcggtgagtaatttggtggtaaatgcgctgcgctac
ggtaatggttgggtcaaagtatcgactggcatgacagcagataacaaactggcttgggta
acggtagaagataatggtccgggtattccacaagaccaaattggtaagttgtttgaaccg
ttcactcgtggtgacacggctcgtggtagtgaagggacaggtttaggtttagcgatcgtg
aaacgtattgtcagccaacaccaaggtgcggtggtggtgaataaccgcagtgagggtggc
ttgaaggcgcagatcagtttccctgtgaaaccttag

DBGET integrated database retrieval system