KEGG   Vibrio tasmaniensis: VS_0253Help
Entry
VS_0253           CDS       T00812                                 

Definition
(GenBank) Phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00564  Glycerophospholipid metabolism
vsp01100  Metabolic pathways
vsp01110  Biosynthesis of secondary metabolites
Module
vsp_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    VS_0253
Enzymes [BR:vsp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     VS_0253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: CAV17284
UniProt: B7VHS2
Position
1:complement(251497..252408)
Genome map
AA seq 303 aa AA seqDB search
MDKIKVGLQYWIPQHGLTRLVGKLASAKAGGLTTAIINWFIKQYKVNMDEALHSDPKHFK
TFNEFFVRELKEGMRPIAEGDSVIVHPADARVSQFGPITDGQLIQAKNHNYSARELLGGD
ADLADEFKDGEFATLYLSPSDYHRVHMPCDGTLRQMIYVPGDLFSVNPLTAENVPNLFAR
NERVVCIFDTEFGPMAQVLVGATIVGSIEQVWAGTITPPRGNSVYKWDYPAQGDKSIILK
KGEEMGRFKLGSTVINLFAKDAIKFDDTMQNGEKTVLGTPFAHIAGKDVETEAVDSAENT
DQA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggataagattaaagttggattgcagtactggatcccacaacatggcctgactcgttta
gttggtaaactggcgtctgctaaagcgggtggtttaacgacagcgatcattaactggttc
atcaagcaatacaaagtgaacatggatgaagctctgcatagcgatccaaaacactttaag
acattcaatgaattcttcgtacgtgaattgaaagaaggcatgcgccctatcgcagaaggt
gactctgttattgttcaccctgctgatgcacgtgtaagtcagtttggcccaattactgat
ggtcaactgattcaagctaaaaaccataactactcagcacgtgagttgcttggtggtgat
gcagacctagccgatgagtttaaagacggtgaattcgcaacgctttacttgtcgccaagt
gattatcaccgtgtgcacatgccatgcgacggcacactgcgtcagatgatctacgttccc
ggtgatcttttctcagtaaacccgctaacggcagagaacgttccaaacctattcgcacgt
aacgaacgtgtggtttgtatctttgatactgagtttggcccaatggcacaagtgctggtt
ggtgcaactatcgtaggtagcatcgagcaagtatgggctggcaccatcacgccacctcgc
ggtaactcggtttacaagtgggattacccagcacaaggtgataaatctattatcttgaag
aaaggcgaagagatgggtcgcttcaagcttggttcaacggttatcaacctgtttgctaaa
gatgcaatcaagtttgacgacactatgcagaatggtgagaaaaccgttctaggcactcct
ttcgcgcacattgcgggtaaagacgttgagactgaagctgttgattcagcagagaacaca
gaccaagcttaa

DBGET integrated database retrieval system