KEGG   Vibrio tasmaniensis: VS_0928Help
Entry
VS_0928           CDS       T00812                                 

Definition
(GenBank) Ribosomal RNA large subunit methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
vsp  Vibrio tasmaniensis
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:vsp03009]
    VS_0928
Enzymes [BR:vsp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     VS_0928
Ribosome biogenesis [BR:vsp03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    VS_0928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_32 Ubie_methyltran Methyltransf_4 MTS DLH Cytochrom_CIII Pox_I3
Motif
Other DBs
NCBI-ProteinID: CAV17940
UniProt: B7VLA8
Position
1:complement(954189..955004)
Genome map
AA seq 271 aa AA seqDB search
MTYQCPLCHQPLSQNDRTFKCEKNHQFDLAKEGYVNLMPAHHKRSKDPGDNKEMMQARRR
FLEGNHYDPMRQAVVGLCASYLPETTPSLLDIGCGEGYYTNEIAVNLHEKNGATFGLDIS
KIAIKYAAKRYPAVDFSVASSHRLPFSENSLDGILRIYAPCKAEELQRTIKDNGVVITVT
PASRHLYQLRDAIYDGVRLHDEDPEMIEGFTLEHQEQLNYMMELSGSDAFDLLQMTPFAW
KASEEFKQQLTDSKQFNCEADFMLRVYRKQL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacttaccaatgccctttgtgtcaccaacctttatctcaaaacgatcgtacgtttaag
tgtgaaaagaaccatcagttcgacctagcgaaagaaggctatgttaatttgatgccagca
caccacaaacgctcaaaagatccaggtgacaacaaagagatgatgcaggctcgtcgccgc
ttccttgaaggcaaccactacgatccaatgcgccaagccgttgttggtttatgcgctagc
tatctgccagaaacaacccctagcctattagatatcggttgtggtgaaggttattacacc
aatgaaattgcggtaaaccttcacgaaaagaatggcgctacttttggtctcgatatctct
aaaattgctatcaaatatgccgctaaacgctatccagcggtcgacttctcagtcgcttcg
agccatcgcctacccttttctgaaaacagcttagacggcattctacgcatttacgcgcct
tgtaaggcagaagagctgcaacgcacgatcaaagacaatggtgtggtgatcaccgtgacc
cctgctagccgacacctttatcagctgcgtgatgcgatttatgatggcgttcgtttgcac
gatgaagatccagagatgatcgaaggttttactcttgagcaccaagagcaactaaactat
atgatggaactatcggggtcagacgcattcgacctgctacagatgacgccgtttgcttgg
aaagcgagtgaagaatttaaacaacaactcaccgattcaaagcaattcaactgtgaagct
gactttatgctacgagtgtaccgcaaacaactttaa

DBGET integrated database retrieval system