KEGG   Vibrio tasmaniensis: VS_1318
Entry
VS_1318           CDS       T00812                                 

Definition
(GenBank) Hypothetical protein; putative membrane protein
  KO
K11891  type VI secretion system protein ImpL
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VS_1318
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vsp02044]
    VS_1318
Secretion system [BR:vsp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VS_1318
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: CAV18458
UniProt: B7VNA5
Position
1:complement(1419523..1422915)
AA seq 1130 aa
MPKTKSNKSGNTKKTVGISILVSFALFTVVSSIILLTPLNAYLTWALATTAIISTLVGLV
CYWVLSNRSEPSQKESFDKSLIQKRQKQLAYHFKRMVSKQRPKARLTSRYDLPIYLLLSQ
NPNKDKSIITQMGYESYKLDDFGSDIEFPILFWVSEHSILVSVSTGEDQHPEYLKTLCQS
LTAWRPRQAANGLLLTTDVASLLENNEQITQKADELKSTIKTFNQAFGVSLPIYNVISNM
GSISDFCQFFSAFDESKRDDVFGATAPYSKHGGIDADWFNDEYDHLISELIANMSNALAG
QLNQDYRNSIASAPFQFGLLKQNLWLFLNRLYRGEQLSDALQFRGFYFTHDGQSSAQSDL
LASTVSYSVGHEHYQHNEQIPVNQTLFAQYLMTHVILSEHELVGVNKRKENALLVNQVIF
TLSWASLLTAVLLVIKFDFDFQNQREAEADVMLERYKEAISASPYDIENMAENIPNLFSL
QRIYNLYNEPEPWYTLPFMPNSSIKGEIEKAYFAALQKVLIPSMENTLEKDLFVYVNLED
QSQTLALLNNYRLLFSKNRTNLHELKNYYMRTFQDQGEADSVNIAQLEVLLNDIFARNLT
PVKSNHDLENLAKKVITQTGIGTLLYEHIQSSETYSKRVDIRSDLGDNWGSVLQFPTSYV
GYLVPYIYTPTGFNELDLSVNSPTLKAALQSYEGVAGAYPSALEMHRISRELKQTYQNDY
INYWRDLISNVKVNEIADPAQLKKAFASLSSANSNPLVSLYSTVAKYTYVELEIPDNEGK
SQDPATIPIQDQDKKESARQITLSFQAYKKQVSANDQGKKPIDNLLSAIINANKWADKFY
ETKEPQKVAFDTLSVTLQAGNPIASLSNLSNDHLAVAEEVISKIVHQSNEMVMSLAHDHL
NTAWSNEVYQPYQQRLASFYPFNRQSKLDVSVADLKAFFVTNGIVDKFSQNRLNGFVKNN
DEAPYLPGLLPGTALSITPDVWTMMDKASDIKNALFLADPSNIQIDFQVKAVDMTPNITE
FSIISDKPIFTYRHGPTLWSQQSWQGDSEFIEKLGVQLNAQDSIIGQSTVKGTWSWFRLF
GPNVSFSSAQDTQVEFVYGDSKVKLTIKTQGQSNPFVPGFFSGFSLPSDI
NT seq 3393 nt   +upstreamnt  +downstreamnt
atgccgaaaactaaatcaaacaaatcgggcaatacaaaaaaaacagtaggtatctcgatc
ctagtatcttttgccctttttaccgtcgtctctagcataattctattaacacctctcaac
gcatatttgacgtgggctctagctactaccgcaattatatctacacttgtaggcttagta
tgttactgggttcttagcaaccgcagtgaaccatcacaaaaagagtcattcgacaaatcg
ctgattcagaaaagacaaaagcaactggcataccatttcaaacgcatggtcagcaagcaa
cgaccaaaagctcgcttaacgagtcgttacgacctgccaatctacctactattgagtcaa
aatccgaataaagacaaaagtatcatcactcaaatgggttatgagtcatataagctcgac
gattttggcagtgatattgaattcccaattctattttgggtcagcgagcattccatttta
gtttcggtaagcactggcgaagatcaacacccagaatacctaaaaacactctgtcagtcc
ctaacagcatggcgcccgaggcaggccgcgaatggtttattgctcacgactgacgtagct
tcattgttggaaaataatgaacaaataacacaaaaagctgatgaactaaaatcgacaata
aaaacgtttaatcaggcttttggggtcagcttacctatttataacgttatctctaacatg
ggtagcatcagcgatttttgtcagtttttctcagcatttgacgaatcaaaaagagacgac
gtattcggcgccacggctccttattctaaacacggtggtatcgacgcagactggtttaat
gatgaatacgaccatttaatcagtgagttgatagccaacatgagcaacgcgcttgcaggt
caactcaaccaggattatcgaaactcaattgctagcgcccctttccagtttggattattg
aaacaaaacctttggttgttcctcaaccgcttgtaccgtggagagcagcttagtgacgct
cttcaattccgcggattttactttactcatgatggtcaaagctcagctcagtctgacttg
ttggcgagcactgtatcttattcggtaggtcatgagcattatcaacacaatgagcagatc
ccggttaaccagaccctttttgctcaataccttatgacacacgtgattttatccgagcac
gaactggttggggtaaacaagcgtaaagaaaacgcattgttagttaaccaagtgattttc
acactatcttgggctagcttactaaccgccgtattacttgtgattaagtttgactttgat
ttccagaatcaacgagaagctgaagccgatgtaatgcttgagcgctataaagaagcgata
tcagcatctccttacgacatcgaaaacatggctgaaaacatacctaatctgttttcatta
cagcgaatttataacctctataatgagcctgagccatggtatacgctgccatttatgcct
aactctagtatcaaaggagagatcgaaaaagcatattttgcagcgttacagaaagtactg
attccttctatggaaaataccctagagaaagacctatttgtgtacgtcaatctcgaagat
caatctcagactctagctttgctgaataactaccgtttattgttcagtaaaaataggact
aaccttcatgagcttaaaaactactacatgcgtacattccaagaccaaggtgaagcagat
agtgtcaatattgctcaactagaggtgctactgaatgacatcttcgcgcgtaacctaaca
ccagtgaaatcaaatcacgatttagagaacctagcgaagaaagtcattactcaaacaggt
atcggaactctattgtatgaacacattcaaagttcagaaacctactcaaagcgcgtcgat
attcgaagtgatttaggcgataattggggttcagttctacaattcccaacaagttatgtg
ggctacctggttccatatatctatacaccaacggggtttaatgagctcgatttatccgtc
aactcacctactctaaaagcagccttacaatcatatgaaggggttgcaggggcctatccg
agtgcactcgaaatgcacagaatcagccgtgaactaaagcaaacttatcaaaatgactac
ataaattattggcgagatctcattagcaatgtaaaagtcaatgaaatagcggatcctgca
caactaaaaaaagcattcgctagcctatcaagtgcaaacagtaacccactggtcagcctg
tactcaaccgtcgctaagtacacctatgtggagctcgaaataccagacaacgagggtaaa
tcgcaagatcctgcgaccataccaattcaagaccaagataaaaaagaatctgcacgccag
ataactttaagctttcaagcatacaaaaaacaggtctctgccaacgatcaagggaagaag
ccaatagacaatctgctgagtgcgattattaatgcaaataaatgggcagacaagttttat
gaaaccaaagaacctcaaaaagtagccttcgatactttatctgtgactttgcaagctggt
aaccctattgcatcattatcgaacttatcaaacgatcatttagctgtagcagaagaagtg
ataagtaaaattgtgcatcaaagtaatgaaatggtgatgtcgctggctcatgaccacctt
aatacagcatggtcaaacgaagtttatcaaccataccaacaacgattagcgtctttttat
ccattcaaccgacagtccaaactggatgtgagcgttgctgatctcaaggccttcttcgtt
acaaacggtatagttgataagttctctcaaaatcgcctcaatggattcgttaaaaacaat
gacgaagcaccttacttaccagggctgttgcctggtactgcgctatctatcacgccagat
gtatggacaatgatggacaaagcttctgatatcaaaaacgctcttttcctagctgatcca
tcaaacattcagatcgatttccaagtaaaagctgttgatatgacaccaaacattaccgaa
ttttcaatcatttcggacaaaccgatcttcacttaccgtcacgggccgaccttatggagt
cagcaatcatggcaaggagactccgagtttatcgagaaactaggagtccagttgaacgca
caagactccataattggccaaagtacagtcaaaggtacatggagttggttccgcttattc
ggtccaaatgtgagtttttcatccgctcaagatacacaagttgagtttgtgtatggtgac
agtaaagtaaaactgaccatcaaaactcagggtcagtcgaacccgtttgttcccggcttc
ttctctggattctcgttaccaagtgatatctag

DBGET integrated database retrieval system