KEGG   Vibrio atlanticus: VS_1328
Entry
VS_1328           CDS       T00812                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
vsp  Vibrio atlanticus
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vsp02044]
    VS_1328
Secretion system [BR:vsp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VS_1328
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: CAV18468
UniProt: B7VNB5
Position
1:complement(1434915..1436666)
AA seq 583 aa
MTEPIMRYFEQELAFVRRSLGQFGQEYPTHAENLNIHQGKIEDPSMARLLDGVALLNAKV
EKKLSEQLPEVIEGILSVLYPSYIQTVPSVAYLELHTEDGPIESSSLPKGSLFSSTNTKN
ECLFKTVDELNIAPFNLSNARALSAPFSFNRPSTANQSSAVVQISLSTGDPDVYFSHLEL
GDLDFFVKGFENNADSLVDLLLNNTLSISISDSECAQHSTVDNLQLKNRISDLEFKFLPE
HGNQFTGYQLINEFFFFKEKRQFFRLKNFAEHANKFDESEIVINLFMSSLPSEFIRLFNK
DVFKLNVVPAINLFEQTGEPIPYDHRTLSVPVNADAHSDNNIEIIEIQNVYEITPNGEVP
LIPLFKEKYSHNQSYDYWQSKHDHFGEVSIAISLSDTTNTEFSKLLGTKLLCTNGKQACG
VIGTLECLESIDLPGDFSPIYPPSAPIKKEIDQNIHWEFISLLNTNFTSLVQSSNPVAEL
KHMLSLCSRDQVSSTEIQMIHSITFNSQVSAIRVLGKNVFSPGTEIELTLDATSPYLAFA
DVLNRFFQQFCSFDRYIQLKIRLYGRDGFIKTYPKIHGSQLCL
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgactgaacccattatgcgttacttcgagcaagaactggcctttgtgcgccgttcgtta
ggtcagttcggtcaggaataccctactcatgccgaaaacctcaatatccatcaaggtaag
atcgaagaccctagcatggctcgcttactcgacggtgtagcactattgaacgcaaaggtc
gaaaagaaactatctgaacagttgcctgaagttatcgaaggtattttgagtgttctctac
ccttcttatattcaaactgttcctagtgttgcttatcttgaacttcatactgaagacggt
cctattgaatcaagcagcttgcctaaaggctcacttttttcaagtacaaacacgaaaaac
gagtgcctatttaagaccgttgacgaactcaatatagcaccatttaatttaagcaatgcc
agagcattgagtgcgccgtttagtttcaacagaccttcaacagctaaccaaagctccgcg
gttgttcagatatctctgagtactggtgatccggatgtttatttcagccatttagaatta
ggtgatctcgatttcttcgtcaaaggcttcgaaaataatgctgactctctcgtcgatttg
cttctcaacaataccttgtcgatttccatttccgattccgagtgtgcccaacactcgacc
gttgataaccttcaactaaaaaatcgaattagtgatctcgagtttaagttcttgcctgaa
cacggaaatcaattcaccggttatcaactgatcaatgaattcttctttttcaaagagaag
cgacagttctttagactaaaaaactttgctgaacacgcgaacaaatttgacgagtctgaa
atcgtgattaatttgtttatgtcatcattgccatcggagttcattcgtctatttaataaa
gacgtattcaagctcaatgtcgtgcctgcgattaatttatttgagcaaactggcgaaccg
atcccatatgaccaccggactctatccgttccagttaatgccgacgctcatagtgacaac
aatatagaaatcattgaaattcaaaacgtctatgaaatcactccgaacggagaggtccct
ttaattccactttttaaagaaaagtattcacacaatcaaagttacgactactggcaaagt
aaacacgatcactttggtgaagtaagcatagcgatttcgttatcggacacgacaaataca
gaatttagcaagctacttggtaccaagttactgtgtacaaatgggaagcaagcttgtggt
gtaatcggcactttggaatgcttagagagtattgatttacccggtgatttctcacctatt
tacccgccgtctgcgccgattaaaaaagaaatcgaccaaaacatccactgggaatttatt
agcttattgaacaccaacttcacatcattggtgcaatctagcaacccggtagctgaactc
aaacatatgttgagtttgtgcagtcgcgaccaggtatcaagcacagaaattcagatgatt
cactcaattacattcaattcgcaagtttctgcaattcgtgtgttgggtaagaacgtgttc
tcgcccggaaccgagattgaacttacgcttgatgccacctcaccttacctagcatttgcc
gatgtgttgaatcgcttcttccagcagttttgcagttttgatagatacattcaacttaag
attcgtctctatgggcgagatggtttcataaaaacataccctaagattcacggtagccaa
ttgtgcctgtaa

DBGET integrated database retrieval system