KEGG   Vibrio tasmaniensis: VS_1331Help
Entry
VS_1331           CDS       T00812                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
vsp  Vibrio tasmaniensis
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vsp02044]
    VS_1331
Secretion system [BR:vsp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VS_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: CAV18475
UniProt: B7VNB8
Position
1:complement(1438513..1439991)
Genome map
AA seq 492 aa AA seqDB search
MSTETENQAQAEATEGSLSFLDRAIEATTQTPADTTKELFSVLTEQALSGTVTWDKNVTK
TIENAISEIDKKLSQQLSEVMQQKDLQKLEGSWRGLQKLVKESELGRDLKIKMVDFTQEE
LLDQFEDAPAIDRSPLFNAVYQGEFGTAGGQPYGTFIGDYEFSAKDEDVALLRYMGEVAA
ACHAPFIAAANAEMFEFNSFQTFSEGKPVAAGFDSPAYAAWNSFRESDDARYVTLTLPRT
LARLPYGDKGLSTDVFAYEELATDMDGSPKPTSNDQLVWSNAAYELGLKMTQAYTASGWC
TSIRGLDNGGKVENLPNLTYKSEAGDLLQQCPTEVNLTDEREKELSDLGFLPLVHYKSSN
YAVFIGGQTTQKPKTFTDPDATANAAISARLPYIMASSRIAHYLKVMGRDKLGSNLEAPD
IKRELQLWIDQYTNAGAIGNEQRAKTPLCESRIEVVEQPGKPGAYSAVAHLRPWLQLEEL
TTSVRMVAKIPG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaaacagagaatcaagcgcaagcagaagctacagaaggctcactcagcttt
ctagaccgagcgattgaagcaaccactcaaactccggcagatacaacgaaagagctgttt
tctgtacttacagagcaagcactttctggaacagtaacgtgggataaaaacgttactaag
acgattgagaatgcaatctctgagatagataagaaactatctcaacagttatctgaagtc
atgcagcagaaagacttgcagaaacttgaaggctcttggcgtggtctacaaaagcttgtt
aaagagagtgaacttggccgtgatctaaagattaaaatggttgatttcacacaagaagag
ctgcttgaccaatttgaagacgcaccagcaattgaccgaagcccattattcaatgcggtt
tatcaaggtgagtttggtactgctggtggtcagccttacggtactttcattggtgattac
gagtttagcgcaaaagatgaagacgttgctctacttcgctacatgggtgaagttgctgca
gcatgtcatgcaccgttcattgccgctgcaaatgctgaaatgttcgagttcaacagcttc
caaactttctctgaaggcaaacctgtagcagcaggcttcgactctcctgcatacgcagca
tggaattcattccgtgaaagtgacgatgcacgttacgtaacactaacgctgcctcgcact
cttgctcgtctaccgtatggtgataaaggtctaagtactgatgtattcgcatacgaagag
cttgcaaccgatatggatggcagtccaaagccaaccagcaatgaccaattagtttggtcg
aatgctgcatatgaactgggtcttaaaatgactcaagcatatactgcttcgggttggtgt
acatctatccgtggacttgataacggtggtaaagtagaaaacctacctaacttaacctac
aagtctgaagctggcgatctacttcagcagtgtccaacagaagtgaatctaactgacgag
cgcgagaaagagctttcagaccttggtttccttcctttggttcattataaaagttctaac
tacgctgtgttcatcggtggccaaacaactcagaaacctaaaacatttacagacccagac
gcaacagcgaatgctgctatctctgctcgcctaccttacattatggcaagtagccgtatc
gcccactacctgaaagtaatgggtcgagacaagctaggttcaaaccttgaagctcctgat
atcaaacgagagctacaactatggatcgaccaatacaccaacgccggtgctattggtaat
gagcaacgcgcaaaaacccctctttgtgaatctcgcatcgaagtggttgagcaacctggt
aagccaggtgcctactcagctgtggctcacctaagaccttggttacaacttgaagagctg
acaacctcagttcgaatggttgctaagattcctggttaa

DBGET integrated database retrieval system