KEGG   Vibrio tasmaniensis: VS_1337Help
Entry
VS_1337           CDS       T00812                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VS_1337
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vsp02044]
    VS_1337
Secretion system [BR:vsp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VS_1337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Phage_base_V DUF2345 DUF3540 Sarcoglycan_1
Motif
Other DBs
NCBI-ProteinID: CAV18486
UniProt: B7VNC4
Position
1:complement(1443693..1445192)
Genome map
AA seq 499 aa AA seqDB search
MLKKGFITFSNVHIFQHSDSDHVMMLQDAQSPYKKSDIGKLDMIEVPSGNNPLLDKWMPQ
GQFHGASIELTSYDYSQTKLVSSKQKKSSHKIANNTKLTKQFYPNLGITGGMEDLASNLV
KRRIEQLEQNYQTVEAEAQHDSFELGKWFSLSSHLDKDQLGDYLVTELYTSYSTENHCQT
RLTLLDTSTPNYPSLTDKAKIHGLQSAIVAGNTAGEINQDEQGRVRIQFHWDTQTSGDKT
SCYVRVAQMMAGNGYGAQFIPRVGQEVLVSFIDGDPDQPIITGSVYNSKNPPPYKEANST
KTGISTKLSGLANELYFDDKKDNELLYMHATKDFTKEIENNLTETIKGELIQKTTKQVNV
STEDNYTLNSDKAIAAKGKSISLEADDKIELKVGSSKITMSSSSISIEASNIDIKASSAL
NLEGMNVTSKATSANKISGVTTALEATSSNSIKGLSVAIKADTTLTAEGSLSAEFKSGLK
GTFNGGVLGELKGAIVKVN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
ttgctgaagaaggggttcattactttttccaacgttcatattttccaacacagcgactca
gatcacgtgatgatgctacaggacgctcagagcccttataaaaagtcagatatcggtaaa
ctggacatgattgaagtcccttcaggcaacaatccattactcgataaatggatgccacaa
ggtcaatttcatggcgccagcatcgaactgactagttatgattactcacaaactaagctc
gtgagcagtaaacagaaaaaatccagccataagatagctaacaacaccaagttaacgaaa
cagttttaccctaaccttggtataactggtgggatggaagaccttgccagtaacctagtg
aaaagacgcattgaacagctcgagcaaaattatcaaaccgtagaagccgaagcgcaacac
gattcatttgaattgggcaagtggttttcactatcatcccatttagacaaagatcaactc
ggtgactatttagtcacagaactttacacgagttatagcaccgaaaaccattgtcaaaca
cgtctcacccttcttgacacgtcgactcctaattatccttcactgacggataaggcaaaa
atacacggactacaaagcgccatcgtagccggcaataccgctggtgagattaatcaagat
gaacaaggtcgagttcgcattcaatttcattgggatacacaaacatccggagacaaaacg
agttgctacgtgcgtgttgctcagatgatggctggcaatggttatggtgctcagtttatt
ccaagagtaggacaagaagtactggtcagttttattgatggtgacccagaccaaccgatt
atcacaggaagcgtttataacagtaaaaacccaccaccttacaaagaagctaactcaacg
aaaacaggcattagcactaagttaagcggattggctaacgagctctattttgacgataag
aaagacaatgagctcttgtacatgcatgcaaccaaagacttcacgaaagaaatagagaac
aacctgacagagaccattaaaggtgaactaatccagaaaaccaccaaacaagttaacgtc
tcaacagaagataattacaccctcaactcagacaaagctatcgctgccaaaggtaaatct
atatccctagaagcggatgacaagattgagctaaaagttgggtccagcaaaatcactatg
tcttcatcttctattagtattgaagcaagtaacattgatatcaaagcgagtagcgcactc
aaccttgaaggcatgaacgtaacaagtaaggcgacatccgcgaacaagatatcaggtgta
acaaccgctctcgaagcgacaagctccaacagtattaaaggactcagtgtcgcgattaaa
gcggatactacactcacagcagaggggtctttaagtgccgagtttaaatcaggcctaaaa
ggtacttttaatggcggcgtacttggcgaattaaagggcgctattgtaaaggtgaattag

DBGET integrated database retrieval system