KEGG   Vibrio tasmaniensis: VS_2014
Entry
VS_2014           CDS       T00812                                 

Definition
(GenBank) Cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    VS_2014
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vsp01007]
    VS_2014
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vsp03016]
    VS_2014
Enzymes [BR:vsp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     VS_2014
Amino acid related enzymes [BR:vsp01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   VS_2014
Transfer RNA biogenesis [BR:vsp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    VS_2014
 Prokaryotic type
    VS_2014
SSDB
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1
Other DBs
NCBI-ProteinID: CAV19191
UniProt: B7VGZ1
Position
1:complement(2160493..2161878)
AA seq 461 aa
MLKIYNTLTRQKEEFKPITAGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVTRYLRYLGYD
LNFVRNITDIDDKIIKRANENGESCDSLTERLIGEMHADFDALNMKRPDVEPRATEFITE
IIELVEKLIQRGFAYVASNGDVMFEVKKFDEYGKLSKQDLDQLQAGARVDIDSAKRSPLD
FVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSSILGNHFDIHGGGSDLQFPHHENEIA
QSCCAHGTQYVNTWMHSGMVMVDREKMSKSLGNFFTIRDVLQHYDAETVRYFLMSGHYRS
QLNYSEDNLNQARASLERLYTSLRGLDVTAAPAGGEEYVTRFSTAMNDDFNTPEAYSVLF
EMAREINRIKTESIEKASALGALMRELADIIGILHQDPEAFLQGDAAGNDDEVAEIEGLI
KLRNDSRASKDWANADLARDKLNELGIVLEDGPEGTTWRRK
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgctgaagatatataacacgctcacaagacagaaagaggaattcaaaccaattacagct
ggcaaagtcggtatgtatgtctgtggggtaaccatatacgatctctgtcatattggtcat
ggccgtacgttcgtttcatttgacgtggtaactcgttacctgcgttaccttggttacgat
ttgaatttcgttcgtaatatcactgatatcgatgacaaaatcatcaagcgcgctaatgaa
aacggcgagtcttgtgactctctgactgagcgtctgatcggtgaaatgcacgcggacttc
gatgcattgaacatgaaacgcccagatgtcgagcctcgtgcgactgaattcatcacagag
atcattgagttagtagaaaagctaattcaacgtggctttgcttacgttgcaagcaacggt
gacgtgatgttcgaagttaagaagtttgacgaatacggtaagctttctaagcaagatctt
gatcagcttcaagcgggtgctcgtgttgacatcgattctgcaaaacgtagcccgttagac
tttgttctttggaagatgtctaagcctggtgagccgacgtgggaatcgccatgggggcca
ggtcgtccaggttggcacatcgaatgttcagcaatgaactcgtctattcttggtaatcac
ttcgatattcatggtggtggttcagatctacagttcccgcaccacgagaacgaaatcgca
caatcttgctgtgcacatggcacccagtatgtgaatacttggatgcacagtggcatggtg
atggtagacagagaaaaaatgtctaagtcattgggtaacttcttcactatccgtgacgta
cttcagcattacgatgcagagacagttcgttacttcctgatgtctggtcactaccgtagc
caactgaactacagcgaagataacctaaatcaggctcgtgcatcacttgaacgtctctat
acatcacttcgtggtctagacgttaccgcagcccctgctggtggtgaagagtatgtgact
cgtttctctacagcgatgaacgatgatttcaacacacctgaagcttattcagtgctgttt
gaaatggctcgtgaaatcaaccgtatcaagactgaaagcatagaaaaagcaagtgcacta
ggtgcgttgatgcgtgaactggcagacatcatcggtattcttcaccaagatccagaagct
ttcttgcaaggcgatgcagcaggtaacgatgacgaagtcgctgaaatcgaaggcctaatt
aagctacgtaatgactctcgcgcttcgaaggattgggcaaatgccgatcttgcacgtgat
aagctgaacgagctaggtattgttctggaagatggtccagaaggtacgacttggcgtcgt
aagtaa

DBGET integrated database retrieval system