KEGG   Vibrio tasmaniensis: VS_2247Help
Entry
VS_2247           CDS       T00812                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00020  Citrate cycle (TCA cycle)
vsp00190  Oxidative phosphorylation
vsp00650  Butanoate metabolism
vsp01100  Metabolic pathways
vsp01110  Biosynthesis of secondary metabolites
vsp01120  Microbial metabolism in diverse environments
vsp01130  Biosynthesis of antibiotics
vsp01200  Carbon metabolism
Module
vsp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vsp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vsp_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VS_2247
   00650 Butanoate metabolism
    VS_2247
  Energy metabolism
   00190 Oxidative phosphorylation
    VS_2247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: CAV19410
UniProt: B7VI40
Position
1:complement(2415589..2415936)
Genome map
AA seq 115 aa AA seqDB search
MVNNVSTFGRNGVHDYLLIRATAIIMTLYTIYLVSFCAFSGDISYASWTQFFGGTFTKVF
TMLALTSILVHAWIGLWQVLTDYIKCAKLRVGLQVGVVAVLLGYFFSGLFILWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaacgtttctacttttggtcgtaatggtgtgcatgattatctattgattcgt
gcaacagccatcattatgacgctttacactatctacctagtgagcttttgtgctttctca
ggtgatatttcttacgcatcttggacgcaattctttggtggtactttcactaaagtcttc
accatgttagcgcttacttcaattttggttcacgcgtggatcggcttgtggcaagtacta
actgactacatcaaatgtgcaaaattgcgcgttggtcttcaagtcggtgttgttgcggtt
cttctaggatatttcttctctggtctgtttattttgtggggtgcgtaa

DBGET integrated database retrieval system