KEGG   Vibrio tasmaniensis: VS_2264Help
Entry
VS_2264           CDS       T00812                                 

Definition
(GenBank) Asparagine synthetase B, glutamine-hydrolyzing
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00250  Alanine, aspartate and glutamate metabolism
vsp01100  Metabolic pathways
vsp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VS_2264
Enzymes [BR:vsp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     VS_2264
Peptidases [BR:vsp01002]
 Cysteine Peptidases
  Family C44
   VS_2264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: CAV19427
UniProt: B7VII1
Position
1:2433849..2435519
Genome map
AA seq 556 aa AA seqDB search
MCSVFGILDIKSDAAALRPIALEMSKKLRHRGPDWSGIYAGEKAILAHERLAIVGLNSGA
QPLYSQDKKHILAVNGEIYNHKELRARYEDKYQFQTDSDCEVILALYQEMGADLLEELNG
IFAFVLYDEEKDEYLVGRDHIGIIPLYQGYDEHGNYYVASEMKALVPVCKTISEFPPGSF
YSSKDAEPQRYYIRDWNEYAAVQGNSTSKEELTEALEAAVKRQLMTDVPYGVLLSGGLDS
SITSAVAKRFAAMRIEDDEQSEAWWPQLHSFAVGLENAPDLIAAREVADKIGTVHHEMTY
TIQEGLDAIRDVIYHIETYDVTTIRASTPMYLLARKIKAMGIKMVLSGEGADEIFGGYLY
FHKAPNAKEFHEETVRKLLALSMFDCARANKSLAAWGVEGRVPFLDKEFIDVAMRLNPED
KMCGNGKMEKHILRECFEDYLPDSIAWRQKEQFSDGVGYDWIDTLKATAEEKVTDQQMEA
AQFRFPYNTPTTKEGYAYREIFEELFPLESAAECVPGGPSVACSSAKAIEWDESFKNCVD
PSGRAVQAVHNDAYNA
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcagtatttggcattctcgacattaaaagtgatgccgcagcacttcgccctatt
gctttagaaatgtctaaaaagcttcgtcaccgtggcccagactggtctggtatctatgcc
ggtgaaaaagctatccttgctcacgagcgtctagctatcgtcggcttaaacagtggtgct
caaccactatacagccaagacaaaaagcacattcttgcagttaatggcgaaatctataac
cacaaagaacttcgcgctcgctacgaagataaataccagttccaaactgactctgattgt
gaagtcattcttgcgctttaccaagagatgggtgccgaccttttagaagaacttaacggt
attttcgctttcgttttatatgacgaagagaaagacgaatacctagtcggccgcgaccat
attggcatcatcccgctttaccaaggctacgatgagcacggcaactattacgttgcttca
gagatgaaagcactggttccagtttgtaagacgatcagtgagttccctcctggtagcttc
tactcttctaaagatgcagaacctcaacgctactacatccgcgattggaacgaatacgca
gccgttcaaggtaacagcacaagcaaagaagagctaactgaagcgctagaagctgctgtt
aagcgtcaactaatgactgacgttccttacggtgtacttctatctggtggccttgattca
tcaatcacttctgcagtcgctaagcgttttgcagcaatgcgtatcgaagatgatgagcaa
tcagaagcttggtggccacaactacactcatttgctgttggcctagaaaatgctcccgac
ttgattgctgcacgtgaagttgcggacaaaatcggtactgtacaccatgagatgacttac
accattcaggaaggcttagatgccatccgtgatgttatctaccacatcgaaacttacgat
gtaacgaccattcgtgcatcgacgccaatgtacttgcttgctcgtaagatcaaagcaatg
ggtatcaaaatggtactttctggtgaaggtgctgatgaaatctttggcggctacctgtac
ttccataaagcgccaaacgcaaaagagttccacgaagagacggtacgtaaacttcttgct
ctaagcatgtttgactgtgcccgtgcaaacaaatcacttgcagcatggggagtcgaaggt
cgtgtaccattcttggataaagagttcatcgatgtggctatgcgtttaaaccctgaagac
aaaatgtgcggtaacggtaaaatggagaaacacatcctacgtgagtgttttgaagactac
ttaccagattcaatcgcatggcgccaaaaagaacagttctctgatggtgttggctacgac
tggattgatacattgaaagcaacggctgaagaaaaagtaacggatcaacaaatggaagct
gctcagttccgtttcccttacaacacaccaacaaccaaagaaggttatgcttaccgtgaa
atctttgaggagctattccctctagaatcggcggcagagtgtgtacctggcggcccttca
gttgcctgttcatcagcaaaagcgatcgagtgggatgagtcattcaaaaactgtgtagac
ccatcaggccgtgcggtacaagccgttcacaacgacgcctataacgcttaa

DBGET integrated database retrieval system