KEGG   Vibrio tasmaniensis: VS_2540Help
Entry
VS_2540           CDS       T00812                                 

Definition
(GenBank) Dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00010  Glycolysis / Gluconeogenesis
vsp00020  Citrate cycle (TCA cycle)
vsp00260  Glycine, serine and threonine metabolism
vsp00280  Valine, leucine and isoleucine degradation
vsp00620  Pyruvate metabolism
vsp00630  Glyoxylate and dicarboxylate metabolism
vsp00640  Propanoate metabolism
vsp01100  Metabolic pathways
vsp01110  Biosynthesis of secondary metabolites
vsp01120  Microbial metabolism in diverse environments
vsp01130  Biosynthesis of antibiotics
vsp01200  Carbon metabolism
Module
vsp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vsp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vsp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VS_2540
   00020 Citrate cycle (TCA cycle)
    VS_2540
   00620 Pyruvate metabolism
    VS_2540
   00630 Glyoxylate and dicarboxylate metabolism
    VS_2540
   00640 Propanoate metabolism
    VS_2540
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VS_2540
   00280 Valine, leucine and isoleucine degradation
    VS_2540
Enzymes [BR:vsp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     VS_2540
Exosome [BR:vsp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   VS_2540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_oxidored GIDA Pyr_redox_3 HI0933_like FAD_binding_2 NAD_binding_8 FAD_binding_3 AlaDh_PNT_C Thi4
Motif
Other DBs
NCBI-ProteinID: CAV19701
UniProt: B7VK11
Position
1:complement(2730181..2731611)
Genome map
AA seq 476 aa AA seqDB search
MSKEIKAQVVVLGSGPAGYSAAFRCADLGLETVLVERYSTLGGVCLNVGCIPSKALLHVS
KVIEEAKAMAEHGVVFGEPQTDINKIRIWKEKVVDQLTGGLGGMAKMRNVTVVNGFGKFT
GPNSILVEGEGEATTVNFDNAIIAAGSRPIKLPFIPHEDPRIWDSTDALELNEVPEKLLI
MGGGIIGLEMGTVYHSLGSKVEVVEMFDQVIPAADKDIVKVFTKRIKDKFKLMLETKVTA
VEAKEDGIYVSMEGKKAPAEAERYDAVLVAIGRVPNGALIDAEKAGIEVDERGFINVDKQ
MRTNVPHIHAIGDVVGQPMLAHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWV
GKTEKEAKAEGLNYEVATFPWAASGRAIASDCADGMTKMIFDKETHRVIGGAVVGTNGGE
LLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNKKAVKKKK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagaaattaaagcccaagttgttgtacttggttcaggtcctgctggttactca
gcggcattccgttgtgcggatttaggtctagaaacagtactagttgaacgttacagcact
cttggtggtgtatgtctaaacgttggttgtattccatcaaaagcacttcttcacgtatct
aaagtaattgaagaagcaaaagcgatggcagagcacggcgttgtattcggcgagccacag
acggacatcaacaagatccgtatctggaaagaaaaagtagttgatcaactgactggcggt
cttggcggtatggctaagatgcgtaacgttacagttgttaacggttttggtaagttcact
ggtcctaacagcattcttgttgaaggcgaaggcgaagcaacgacagttaacttcgacaac
gcaatcattgctgcgggttctcgcccaatcaaacttccgttcatcccacatgaagaccca
cgtatttgggactctacggatgcattagagctaaacgaagtaccagaaaaactgcttatc
atgggcggtggtatcatcggtcttgagatgggtacggtttaccactctctaggttctaaa
gttgaagttgttgagatgttcgatcaagttatccctgctgcggataaagacatcgttaaa
gtcttcactaagcgcattaaagataagttcaagctaatgcttgaaactaaagtgactgct
gttgaagcgaaagaagacggtatctatgtttcaatggaaggcaaaaaagcaccagctgaa
gctgagcgctacgatgcagttcttgttgctatcggtcgtgttccaaacggtgcacttatc
gacgctgaaaaagcaggtatcgaagttgatgagcgcggtttcatcaatgttgataagcaa
atgcgtactaacgttcctcacatccacgcgatcggtgatgttgttggtcaaccaatgctt
gctcacaaaggtgtgcatgaaggtcacgtagctgctgaagttatctctggtaagaagcac
tacttcgatcctaaagtaatcccatcaattgcgtacactgagccagaagtagcttgggta
ggtaagactgagaaagaagcgaaagcggaaggcctgaactacgaagttgctaccttccct
tgggctgcttctggtcgtgcaatcgcttcagactgtgctgacggtatgactaagatgatc
ttcgataaagagactcatcgcgtaatcggtggtgctgttgttggtactaatggtggtgaa
cttcttggcgaaatcggcctagcaatcgaaatgggttgtgatgcagaagatatcgcactg
actatccacgctcacccaactctacacgagtctgttggtcttgctgcagaagtattcgaa
ggttcaatcactgaccttccaaacaaaaaagcagtgaaaaagaagaagtaa

DBGET integrated database retrieval system