KEGG   Vibrio tasmaniensis: VS_3017Help
Entry
VS_3017           CDS       T00812                                 

Definition
(GenBank) Thiosulfate sulfurtransferase glpE
  KO
K02439  thiosulfate sulfurtransferase [EC:2.8.1.1]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00920  Sulfur metabolism
vsp01100  Metabolic pathways
vsp01110  Biosynthesis of secondary metabolites
vsp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    VS_3017
Enzymes [BR:vsp01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     VS_3017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-ProteinID: CAV20294
UniProt: B7VMA4
Position
1:complement(3165323..3165643)
Genome map
AA seq 106 aa AA seqDB search
MDQFKHIDVKGAQALIEQNEARLVDIRDPQSFAVAHSETAYHLTNDTMVSFMDEVEFEQP
ILVMCYHGISSQGAAQYLVNQGFEEVYSVDGGFEASYRAELPVIAG
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggaccagtttaaacatatcgacgttaaaggcgctcaagcccttattgaacaaaatgaa
gctcgacttgtcgatatacgagatccgcaatcttttgcggtagcccattcagaaaccgcc
taccacctgactaacgataccatggtgtcgtttatggatgaggttgagttcgaacagcct
atcttagtgatgtgttaccacggtattagtagccaaggcgcggcacaatatttagtgaac
caaggctttgaagaggtatatagtgttgatggcggtttcgaagcttcgtatcgtgctgaa
cttccggtgattgcgggttaa

DBGET integrated database retrieval system