KEGG   Vibrio tasmaniensis: VS_II0152Help
Entry
VS_II0152         CDS       T00812                                 

Definition
(GenBank) Ferredoxin--NADP reductase
  KO
K00528  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09100 Metabolism
  09112 Not included in regular maps
   09113 Global maps only
    VS_II0152
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VS_II0152
Enzymes [BR:vsp01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     VS_II0152
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     VS_II0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6
Motif
Other DBs
NCBI-ProteinID: CAV25444
UniProt: B7VQC2
Position
2:complement(162576..163424)
Genome map
AA seq 282 aa AA seqDB search
MSILNEITSLNKGDDMTDIPHGLVTGKVVHKTEWTEQLFSLQVSAPVSPYQAGQFTKLGL
RNSEGEFVRRAYSMVNAPEHEQGHQHLEFLIIKDQNGQLSPQLHELKVGDDIFVGKDPSG
FMTLEEIPEIADDLWMLSTGTAVGPFISMLESMQIQQHNGSESEKVTSFKNLVLVHAVRT
EQDLTYQDRINQLVNHFQGKLQYVPIISRESVTGTLRGRIPSLLLGGDLEQTTSVTFNQT
RSFFYLCGNPQMVRDTSEALTNLGFEKHLRRKPGQFSSENYW
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttgagtatccttaatgagataacttctctaaataaaggtgatgatatgacagatattcct
catggcttagtaaccggaaaagtcgtacacaagaccgaatggacagagcaactgttctcg
ctgcaagtcagtgcgccagtctcgccctaccaagcggggcagttcactaagctggggcta
cgtaacagtgaaggcgagtttgtcagacgtgcttattccatggtgaatgcgccagagcac
gaacaaggtcatcaacatctggaatttttgattattaaggatcagaacgggcagctttca
cctcaacttcatgagttgaaggtaggcgatgacatatttgtcggcaaagacccaagtggg
ttcatgacattagaggagatcccagagatcgccgacgatctatggatgctttcaaccgga
accgccgttgggccttttatctcaatgctcgaaagcatgcagatacagcagcataacggc
tctgaatctgaaaaagtcacctcgttcaaaaaccttgtactggttcatgccgtaagaaca
gagcaagacctcacgtatcaagatcgaatcaatcaactcgttaatcacttccaagggaaa
ctacaatatgtgccaattatttctagagaatcagtcaccggaactttgcgcggacgaatc
ccaagcttgttacttggaggcgaccttgagcaaaccacgtctgtcactttcaatcaaacc
cgcagttttttctacctttgtggcaatccgcaaatggttcgcgacacaagtgaagcacta
accaacttaggtttcgagaagcacttacgccgaaagcccggccaattcagcagtgaaaac
tactggtaa

DBGET integrated database retrieval system