KEGG   Vibrio tasmaniensis: VS_II0585Help
Entry
VS_II0585         CDS       T00812                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00071  Fatty acid degradation
vsp00280  Valine, leucine and isoleucine degradation
vsp00310  Lysine degradation
vsp00362  Benzoate degradation
vsp00380  Tryptophan metabolism
vsp00620  Pyruvate metabolism
vsp00630  Glyoxylate and dicarboxylate metabolism
vsp00640  Propanoate metabolism
vsp00650  Butanoate metabolism
vsp00900  Terpenoid backbone biosynthesis
vsp01100  Metabolic pathways
vsp01110  Biosynthesis of secondary metabolites
vsp01120  Microbial metabolism in diverse environments
vsp01130  Biosynthesis of antibiotics
vsp01200  Carbon metabolism
vsp01212  Fatty acid metabolism
vsp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VS_II0585
   00630 Glyoxylate and dicarboxylate metabolism
    VS_II0585
   00640 Propanoate metabolism
    VS_II0585
   00650 Butanoate metabolism
    VS_II0585
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VS_II0585
   00072 Synthesis and degradation of ketone bodies
    VS_II0585
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VS_II0585
   00310 Lysine degradation
    VS_II0585
   00380 Tryptophan metabolism
    VS_II0585
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VS_II0585
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VS_II0585
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VS_II0585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vsp04147]
    VS_II0585
Enzymes [BR:vsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VS_II0585
Exosome [BR:vsp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VS_II0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: CAV26186
UniProt: B7VRJ7
Position
2:654884..656095
Genome map
AA seq 403 aa AA seqDB search
MEKVFMVAAKRTPIGAFTGSLKNVSAGELAGVAIKGALESVDLSLDAIDEVIVGNVISAG
QGMGVARQASIYAGLPEETPAYGVNMICGSGMKSVMDAAAHIKAQDAEVVIAAGVEVMSQ
IPFVVPASVRNGHKMGDISMKDLLVGDGLTDAFNHYHMGMTAENIANTLNISRLAQDNYA
LESQQKAVAAIEAGKFNEQIVPVEVKQRRQTVIFDTDEYPKSDATFEGLQKLRPAFDREG
SVTAGNASGINDGASAIILASESAVAKYGLTPLVELTSYAQSGLDPKIMGLGPVEAVSKA
LDKANLTLEEIDLFELNEAFAAQALGVMYQLSEQHDLPLDAFKPKVNVNGGAIALGHPLG
ASGNRIIVSLIHEMLEQKTTYGVASLCVGGGMGTAVLLKGIEG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtatttatggttgcggctaagcgcacgcctattggtgcattcaccgggtca
ctaaaaaacgtatctgcgggcgagttggctggcgttgcgatcaaaggcgcgttggagtcc
gtagatctttcgttggatgcgattgatgaagtgatcgttggtaatgtgatttcggcaggt
caaggcatgggggttgctcgtcaggcttccatctatgcagggcttcctgaagaaacacca
gcatacggtgtgaacatgatttgcggcagcggcatgaagtcggtgatggacgcagcagcg
cacatcaaagcacaagatgctgaagtggttattgctgctggcgttgaagtgatgtcccaa
atcccttttgtagtgcccgcgagcgttcgtaatggtcacaaaatgggtgatatctcaatg
aaagacttactggttggtgatggcttaaccgatgcgtttaatcactaccacatgggcatg
acggctgaaaatatcgccaacacgttaaatatttcgcgcctagctcaagataactatgcc
ctagaaagccaacagaaagccgtcgcagcgattgaagcgggtaagtttaacgagcaaatc
gtgcctgtagaagttaagcagcgcaggcaaaccgtcatttttgataccgatgagtatccg
aagtcagacgcgacattcgaaggtctgcaaaagcttcgcccagcctttgaccgtgaaggg
tctgttacggcaggtaacgcttcgggcatcaatgatggtgcgagtgcaatcatcttagcg
tctgagtcggcagtagcgaaatatggcctgacacctttagtggaactgaccagttacgca
cagtcaggtttggacccaaagatcatggggttaggacctgtagaagctgtttctaaagcg
cttgataaagcgaatctcaccctcgaagaaatagatttgtttgaattgaatgaagcgttt
gcagcacaagctcttggcgtaatgtaccaattgtcagagcagcatgatttaccgcttgat
gcgttcaagccaaaggtcaatgtgaatggtggtgcaatcgcgcttggtcaccctctaggt
gcgtctggcaatcgaattattgtttcactcatccatgaaatgcttgaacagaaaacgact
tatggcgttgcttcactctgcgtgggtggaggaatgggaaccgctgttttgctaaaaggt
attgaaggttag

DBGET integrated database retrieval system