KEGG   Vibrio atlanticus: VS_II0985
Entry
VS_II0985         CDS       T00812                                 

Gene name
vasF
Definition
(GenBank) Type VI Secretion System, VasF
  KO
K11892  type VI secretion system protein ImpK
Organism
vsp  Vibrio atlanticus
Pathway
vsp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VS_II0985 (vasF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vsp02044]
    VS_II0985 (vasF)
Secretion system [BR:vsp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VS_II0985 (vasF)
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: CAV26851
UniProt: B7VTS2
Position
2:complement(1088148..1088954)
AA seq 268 aa
MGCTFMSYVENDITVVLFQPEPGKPMEVMPAPDLSRNIAVRDLNVESMGVNPLVDQFTWL
IASLSCMSSIPWLDDPGPFREQVAREIRKGERKLNEMELDRASILVIRYCLCAAIDESVC
RQEWGANSHWSTNSLLSEFHNETSGGDKFFTILERLKADPRKYRHVIEFLYLLLQLGFKG
KYGREDRGNEKLSEIGNTIYRLVRDERLAEQEKVTLVNLKAKYLKKPLKRVVSPKLILGV
SAAIFGVMYVATYLVIDLKFQQLLDVYQ
NT seq 807 nt   +upstreamnt  +downstreamnt
ttgggctgtacgtttatgagttacgtcgaaaacgatatcaccgtagtactattccaacca
gaaccaggcaaaccaatggaggtgatgcctgcacctgatttatctaggaatattgcggta
agagacctaaatgtagaaagcatgggggttaacccattggttgatcagtttacctggttg
atcgccagtctttcatgtatgtcttcaattccttggctggacgaccctggccctttcaga
gaacaagttgctcgagagattcgcaaaggtgagcgaaagcttaacgaaatggaattggat
agggcatctattctggttatacgctattgcttatgtgctgcaatcgatgaatctgtatgt
cgccaagagtggggggcgaacagccattggagtaccaatagcttattgtcagagttccat
aacgaaacatctggtggcgacaaattcttcactattttagagcgtttgaaagctgaccca
cgaaaatatagacacgtcatcgaattcctttatctattacttcaacttgggttcaaagga
aaatatggtcgagaagaccgtggtaacgaaaagctttcagagataggaaatacgatttat
cgtttagttagagacgagcgtttagctgaacaagaaaaagtaacgttagttaatttaaag
gcgaagtacttaaaaaagccgctaaaacgtgttgtttcaccgaagttaattcttggggtt
agtgctgccatttttggcgttatgtatgtcgcgacctacttggttattgacctgaaattt
cagcaacttctagatgtatatcagtag

DBGET integrated database retrieval system