KEGG   Vibrio tasmaniensis: VS_II0987
Entry
VS_II0987         CDS       T00812                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VS_II0987
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vsp02044]
    VS_II0987
Secretion system [BR:vsp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VS_II0987
SSDB
Motif
Pfam: T6SS-SciN Sortase
Other DBs
NCBI-ProteinID: CAV26853
UniProt: B7VTS4
Position
2:complement(1090273..1090788)
AA seq 171 aa
MPKRIMHKLIAPIILFLLSGCSMWEQFKESSGITPETSSIELVIEASEHLNIREQGQSSP
VILRVHELTSPVMFRSLDFFALFENDKASLGDEYIKRYEYQLQPGDKLHELLELDPKTRA
LGFSVAFRNINGSSWRKVEVIEEKSEYFLRLKVEGSELSSNNTRGIEQTYF
NT seq 516 nt   +upstreamnt  +downstreamnt
ttgccaaaacgaatcatgcataaactaatagctcctattatcttgttccttttatcaggt
tgttcaatgtgggaacagttcaaagaatcttctggaataacgccggaaacctcttcgatt
gaactagttattgaagcgtcagaacacctcaatatacgcgaacaaggacaatcatcgcca
gtcatcttgagagttcacgaattaacgtctcccgttatgttccgtagtttggacttcttt
gctctatttgaaaatgataaggcctccttgggggacgagtacatcaaacggtacgaatat
cagcttcagcccggtgataagctgcatgagctgttggagctagacccaaaaactagagca
ctaggtttttctgtcgcatttagaaatattaatggttcatcttggcgtaaggtcgaagtg
atcgaagagaaaagtgagtacttcttaaggttaaaagtagagggtagcgaattatcttcg
aacaatacccgcggtattgaacagacgtatttttaa

DBGET integrated database retrieval system