KEGG   Vibrio atlanticus: VS_II0988
Entry
VS_II0988         CDS       T00812                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
vsp  Vibrio atlanticus
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vsp02044]
    VS_II0988
Secretion system [BR:vsp02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   VS_II0988
SSDB
Motif
Pfam: FHA Rep_2
Other DBs
NCBI-ProteinID: CAV26854
UniProt: B7VTS5
Position
2:complement(1090766..1092253)
AA seq 495 aa
MRINQLILVISKCPEEYVGAKNIEVPEEGGSLGREAGCTVTLTDHNRFISGTHCLLSIYG
DTYYISDVSTNGTLVNGNKILKNQPVSLCDGDKISLGQYEVSISLELVTTSYDIASEIAP
ERDSTDPLMNLEKSVVEEDVEPGALEDLFMETKPDDVDSHDPVEHLKFSMQRDDDYLVRD
ESNDKNLASTSIEPQRQVVDDSLSIHSEFDLPNLIPEDWMGLEEEAPTTLHAHNLDNEEE
IPGYVQPIHDKDLNGKPEDVIERSSVSKHTSIPVQSVVSARSSANIQSHKWEEVTQEFVP
HVETQELCAESESRSQNNVALSESSSENVTHAFFEGLGADIETDSNHDALFFKQMGACLR
LCIDNLYKNLQGVEELTDENSFTKNELSLTTLMLTLNNQNLLAPNELIEQILDELDEHDA
LYLKTLNDLVFDQLKANDPKKFEDVLSQETRFLSKSKLWQKYGEHYDQNTRQLHESTFKA
LIKERYNKVAKTNHA
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgagaataaatcaactgattttggtgatctcgaagtgcccagaagagtacgttggtgct
aagaatatagaggtgcctgaagaaggaggctctttaggacgagaagcaggctgtaccgta
acattaacggatcacaaccgatttatatctggtacgcattgtttattgagtatatatgga
gatacctattacattagtgatgtcagtacaaatggcacgttggtgaatggtaataagatc
ctaaagaatcaaccagtctcattgtgtgatggtgataagatatcccttggccagtatgaa
gttagtatatcgttagaattggtcacaacatcatacgatattgcctctgaaatcgcccca
gaaagagattcaaccgatccactaatgaatttggaaaagtcagttgttgaagaggacgtt
gaacctggcgcacttgaagacctttttatggaaacaaaacctgacgacgtagacagtcat
gaccccgttgagcacttaaagttttcgatgcaaagagacgacgattatcttgttagggat
gaaagtaatgataaaaaccttgcgagcacgtcgatcgaacctcaaaggcaagttgttgat
gacagtttgagtattcactcggagtttgacctacctaatttgattcctgaagattggatg
ggattagaagaagaggccccgacgactcttcatgcacataatcttgataacgaggaagaa
ataccgggttacgtacaacctattcatgataaagatttaaacggcaaacctgaagacgtt
attgaacgttcttctgtttctaagcatacgtcaattccggtgcaatctgttgttagtgcc
cgaagttctgcgaatatacaaagccacaaatgggaagaggtgacacaagagtttgtccca
catgttgagactcaagaactgtgtgcggaaagcgaaagtagatctcagaataatgtcgcc
ctgagtgaatcatcatctgagaacgtaacacatgcattcttcgaaggcctcggtgcagat
atagaaactgattcaaatcatgacgctctattttttaagcaaatgggcgcgtgtttacga
ttgtgtatcgataatctgtacaaaaacttacagggtgttgaagaacttacagacgaaaac
tcgtttactaagaatgagcttagcctaaccacgttaatgttaacgctaaacaatcaaaat
ctgttagctccaaatgagctcattgaacagattttggatgagcttgatgaacatgacgct
ttgtatttaaaaacactcaacgaccttgtgttcgatcagttaaaagcgaacgaccccaaa
aaattcgaagatgtattaagccaagaaacccgttttctaagtaaatcgaagttatggcaa
aagtacggggaacattatgaccagaatactcgtcaactccatgaatcgacattcaaagcg
ttgattaaagaacgatacaataaggttgccaaaacgaatcatgcataa

DBGET integrated database retrieval system