KEGG   Vibrio tasmaniensis: VS_II1086Help
Entry
VS_II1086         CDS       T00812                                 

Definition
(GenBank) putative transcriptional activator
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00730  Thiamine metabolism
vsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    VS_II1086
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vsp03000]
    VS_II1086
Enzymes [BR:vsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     VS_II1086
Transcription factors [BR:vsp03000]
 Prokaryotic Type
  Other transcription factors
   Others
    VS_II1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: CAV26971
UniProt: B7VS67
Position
2:complement(1223894..1224562)
Genome map
AA seq 222 aa AA seqDB search
MKYQDLIQACQQDWQDYIEHDFVKTLANGTLAQPCFLHYLKQDFLFLKQYARAYALAIYK
AKTLADMRRALPSVHALLDSEISHHVTYCGQWGLTESDLENEPEDFGTVAYTRYVLDAGM
TGDLVDLYAALAPCSIGYAVIGKVLLESSDTVLEGNPYASWLQLYGGEEFQSGVATGAEY
FNQLLAEIDINSERGQNIVHIFKTATRMEVAFWQQGLNALND
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccaagacttaatccaagcctgtcagcaagattggcaagactacatcgagcat
gattttgttaaaacgctggcgaacggcaccctcgcccagccgtgttttttgcattacctg
aagcaagattttctgtttttgaagcagtatgctcgcgcttatgcattggcaatttacaag
gctaaaaccttggctgatatgcgtcgtgcactgccaagtgttcatgcgctgctagattct
gaaatctctcaccatgtgacttactgtggtcagtggggtttaactgagtcggatttagaa
aacgaaccggaagatttcggcacagttgcctacacgcgctacgttctagatgcgggtatg
acgggtgatcttgtcgacttatatgcggcattggctccgtgttcaattggttacgctgtt
atcggtaaagtgttgttagagagcagtgataccgtattagaaggcaacccatatgcgagc
tggttgcaactgtatggcggtgaagagttccagtctggtgtggcaacgggtgcggaatac
ttcaatcaactgcttgctgaaattgatatcaacagcgagcgcggtcagaacatcgttcat
atcttcaaaaccgcaacgcgtatggaagtggctttttggcagcaagggctgaacgctctt
aatgactaa

DBGET integrated database retrieval system