KEGG   Vibrio tapetis: A0131Help
Entry
A0131             CDS       T05424                                 

Gene name
apaG
Definition
(GenBank) protein associated with Co2+ and Mg2+ efflux
  KO
K06195  ApaG protein
Organism
vta  Vibrio tapetis
Brite
KEGG Orthology (KO) [BR:vta00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    A0131 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: SON48110
UniProt: A0A2N8Z892
Position
A:complement(134358..134738)
Genome map
AA seq 126 aa AA seqDB search
MEIPRSCVKCQVHTKYVLEQSEPDNKRYVFAYIITIKNLSNQQVQLISRHWLITDGNGKQ
LSIEGKGVVGVQPVIEAGEEYTYTSATAIETPIGVMQGHYQMLDSAQQTFKAEVEPFRLA
IPNIIN
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggaaatacctcgatcttgcgttaagtgccaagtacacaccaagtacgtactagaacaa
tcagagccagacaacaaaagatatgtcttcgcctatatcatcacaatcaaaaatttgagt
aatcaacaagtacaacttatctcacgacattggctcattactgacggaaacggcaagcaa
ctgtcaatcgaagggaaaggagtggttggcgtgcaaccggttatcgaagccggagaggaa
tacacctataccagtgctaccgcaattgaaacaccaattggtgtcatgcaaggccattat
caaatgctcgattctgctcagcagacattcaaagctgaagtagagccttttcgcttagcg
atccctaacattattaattga

DBGET integrated database retrieval system