KEGG   Vibrio tapetis: A2070Help
Entry
A2070             CDS       T05424                                 

Gene name
adhE
Definition
(GenBank) fused acetaldehyde-CoA dehydrogenase; iron-dependent alcohol dehydrogenase; pyruvate-formate lyase deactivase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
vta  Vibrio tapetis
Pathway
vta00010  Glycolysis / Gluconeogenesis
vta00071  Fatty acid degradation
vta00350  Tyrosine metabolism
vta00620  Pyruvate metabolism
vta00625  Chloroalkane and chloroalkene degradation
vta00626  Naphthalene degradation
vta00650  Butanoate metabolism
vta01100  Metabolic pathways
vta01110  Biosynthesis of secondary metabolites
vta01120  Microbial metabolism in diverse environments
vta01130  Biosynthesis of antibiotics
vta01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A2070 (adhE)
   00620 Pyruvate metabolism
    A2070 (adhE)
   00650 Butanoate metabolism
    A2070 (adhE)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A2070 (adhE)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    A2070 (adhE)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A2070 (adhE)
   00626 Naphthalene degradation
    A2070 (adhE)
Enzymes [BR:vta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A2070 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     A2070 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: SON50049
UniProt: A0A2N8ZDQ6
Position
A:complement(2182678..2185380)
Genome map
AA seq 900 aa AA seqDB search
MPVTNLAELDALVARVKAAQEEFATFSQEKVDAIFRAASLAANQARIPLAQQAVAESGMG
IVEDKVIKNHFASEFIYNKYKDEKTCGVLEENEEFGTMTIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNGIIFSPHPRAKNSTNDAAKLVLDAAVGAGAPKDIIGWIDQPSVELSNA
LMKHDGIALILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDETADIKRAVASVLMSKTF
DNGVVCASEQAVIVMDEVYDEVKERFATHKAHVLSKADADKVRKVLLIDGNLNAKIVGQP
ATAIAEMAGVKVPADTKILVGEGIGEVSYDDEFAHEKLSPTLGMFRASSFENAVAQAVTM
VEIGGIGHTSGLYTNQDTNADRIRYFGDKMKTARILVNIPTTHGGIGDLYNFNVAPSLTL
GCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIAMSDLEGKKR
AFLVTDRFLFNNGYADEIVKLLKAQGIEVQTFFDVEADPTLSVVQKGAEAMKSFQPDVIL
ALGGGSPMDAAKIMWVMYEHPETHFEELAMRFMDIRKRIYKFPKMGEKAELVCVTTTSGT
GSEVTPFAVVTDDKTGAKYPLADYELTPNMAIVDANLVMNMPKSLTAFGGYDAVTHALEA
YVSVLANEYSDGQALQALKMLKEYLPSSYANGAADPIAREKVHNAATIAGIAFANAFLGV
CHSMAHKVGAEFHVPHGLANALLISNTVRYNANDNPTKQTAFSQYASPQARRRYAEVADH
LGLSQVGDRTAQKIERLLAWLEELKIALDIPLSIQAAGVPEADFLAKLDQLSVEAFDDQC
TGANPRYPLISELKEVLTASYYGKAFVEGETFEGTTVIKKTEDQAAAKPATKAKKEKATA
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaacaaatttggctgaactagatgctctagtcgctcgcgtaaaagcagcacaa
gaagagtttgcaacattctcacaagagaaagtagacgcaatcttccgagcagcttctcta
gcagctaaccaagcacgtattcctctagcgcaacaagcggtagcagaatctggcatgggt
attgttgaagacaaagtaatcaaaaaccacttcgcgtctgaattcatctacaacaaatac
aaagacgaaaaaacctgtggcgttctagaagagaacgaagagttcggcacaatgactatc
gctgaaccagtaggcatcatctgtggtatcgttccaacgacgaacccaacgtctacagca
atctttaaatctctaatctctcttaaaactcgtaacggcatcatcttctcgccacaccca
cgtgctaaaaactcgacgaatgatgcagctaagctagttcttgatgcagcagtaggtgcg
ggcgcaccaaaagacatcatcggttggattgaccaaccatctgtagagctttcaaatgct
cttatgaagcacgatggcattgctcttatccttgcaactggcggtccaggcatggttaaa
gcggcttactcttcaggtaaacctgcaatcggtgttggtgctggtaacgttccagttgtt
atcgatgaaactgcagacatcaaacgtgctgtagcatcagttcttatgtctaaaacattc
gataacggtgttgtatgtgcttctgagcaagcagttatcgttatggacgaagtatatgac
gaagtgaaagagcgtttcgctactcacaaagctcacgtactaagcaaagcagacgctgat
aaagtacgtaaagtactgttaatcgacggtaacctaaacgcaaaaatcgttggtcaacct
gcaacggcaatcgctgaaatggcgggtgttaaagttcctgctgatactaagattcttgtt
ggtgaaggcattggcgaagtatcttacgacgacgagttcgctcatgagaaactgtctcca
actcttggtatgttccgtgcttcttctttcgagaacgcagtagcacaagcagtaacaatg
gttgaaatcggtggtatcggtcacacatctggtctttacactaaccaagatacaaacgca
gaccgtattcgttacttcggtgacaagatgaagactgcacgtatccttgtaaacatcccg
actactcacggtggtatcggtgacctttacaactttaacgtagcgccttctctaactctt
ggttgtggttcatggggtggtaactctatctctgaaaacgtaggtcctaagcacctaatc
aacaagaaaactgttgcgaagcgagctgaaaatatgttgtggcacaaactacctaagtct
atctacttccgtcgtggcagccttccaatcgcaatgagcgatcttgaaggtaagaaacgt
gcattcctagtaacggaccgtttcctattcaacaacggttacgctgacgaaatcgttaaa
ttgcttaaagctcaaggtatcgaagttcaaacattctttgatgttgaagcagatccaaca
ctttctgttgttcagaaaggtgctgaagcaatgaagagcttccaaccagacgtgatcctt
gctctaggtggcggttctccaatggatgcggctaagatcatgtgggtaatgtacgagcac
ccagaaactcactttgaagaactagcaatgcgctttatggatatccgtaaacgtatctac
aagttccctaaaatgggtgaaaaagcagagctagtatgtgtaacaactacttctggtaca
ggttctgaagtaacgccatttgctgttgtaacagacgacaaaactggtgctaagtaccca
ctagcagattacgaactcactcctaacatggctatcgttgatgcgaaccttgttatgaac
atgcctaagtctctaacagcgtttggtggttacgatgcagtaactcacgcactagaagct
tacgtttcagttcttgcgaacgaatactcagatggtcaagctcttcaagcgcttaagatg
cttaaagaatacctaccatcaagctacgctaatggcgctgctgacccaatcgctcgtgag
aaagttcacaatgcggcaaccatcgctggtattgcgtttgcgaatgctttccttggtgta
tgtcactcaatggctcacaaagtgggtgcagagttccacgtaccacacggcctagctaac
gcattgttgatttctaacacggttcgttacaacgcgaatgacaacccaacgaagcaaact
gcgttctctcagtacgcaagcccacaagctcgtcgtcgttacgctgaagttgcagaccac
ctaggcctaagccaagttggtgaccgtactgctcagaagattgaacgtctactagcatgg
ttagaagaactgaaaattgctcttgatatcccgctatcaatccaagcagctggtgttcca
gaagctgatttcctagcgaaacttgaccaactatcagttgaagcattcgatgaccaatgt
acaggtgctaacccacgttacccactaatcagtgagctgaaagaagtgctaaccgcttct
tactacggtaaagcatttgttgaaggcgaaacgtttgaaggtacgactgttatcaagaaa
acagaagaccaagctgctgcaaaaccagccactaaagcgaaaaaagaaaaagcgaccgct
taa

DBGET integrated database retrieval system