KEGG   Vibrio tapetis: B1619Help
Entry
B1619             CDS       T05424                                 

Definition
(GenBank) Periplasmic beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
vta  Vibrio tapetis
Pathway
vta00460  Cyanoamino acid metabolism
vta00500  Starch and sucrose metabolism
vta01100  Metabolic pathways
vta01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B1619
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    B1619
Enzymes [BR:vta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     B1619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like FAS_I_H
Motif
Other DBs
NCBI-ProteinID: SON53230
UniProt: A0A2N8ZMT7
Position
B:1659209..1661353
Genome map
AA seq 714 aa AA seqDB search
MTSYQSPDLSIEQRSANLLEMMTVAEKVGQLCQSPMLEYRHNRDEYLAAVKTGRVGSRIL
ADTAWAGNTPGETVDPLQLNEIQRAAVEESRLGIPIIFARDVIYGQKTVLPIPLAQACSW
NPKLVEQAYSGIAREAASLGINWTFAPMLDIVRDPRWGRVIESSGEDPFVASTLAQAVVK
GFQGDDPSKPDRLLACAKHFIGYGAAEGGRDYDTTEITDNTLHNVYLPSFKAAVDAGVAT
LMSGFNDLGGTPVTACRALIRDWLKEQQKFDGVVVSDWGSISDLAYFGVANDESEAAKQA
LLAGVDIAMTNKAYEGVLDALVIDDPKLMKYLDDAVLRVLKAKFRAGLFESPYVDPKLHQ
TVLGHPQHQQWARELAQQSMVLLKNQSQILPLPNEGLKIAVIGPHAHSQRQHLGSWCLDG
DSRDVVSIYEGIKLHGGINTIMTEDSTFSDEMVECAHLADVVVLCVGESHRRTGEARNIA
ELTLPAGQEDLIHAVGRTGKPLIVVQCTGRPVPSPATEQHANALLYAWQSGTETGRVVAD
LLFGDVSPSGKLTMTVPRTTGQIPMYYARKPVGKMRDFREYQAYKDFDCSPLYPFGFGLT
YSQFHYDDLSAAKQNDGSLRVVVRLTNTGSVQASEVVQCYLAHSHASTTRPSRELKAFAR
VCLSAGENEKVVMNISAEQLIHYGADKKWRLESGKITLFVGSDSTCGLSTSVDV
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgtatcaaagccctgatctaagtattgagcaacgaagtgccaatctgttagag
atgatgaccgttgctgagaaggttgggcaactgtgccaatcaccgatgctagagtacaga
cataatagagatgagtatttagcagccgtaaaaacaggaagggttggttctcgtatttta
gccgacacagcttgggctggtaacaccccgggggaaacagttgatccattacaacttaat
gaaatacaaagagcggcagtagaggaaagtagattaggtatcccgatcatttttgctcga
gatgtaatttatgggcagaaaacggttcttccgattccacttgctcaagcctgctcttgg
aatcctaaattggttgaacaagcttattcaggaattgcaagagaggcggcatctcttgga
ataaactggacgttcgcgcctatgttagacattgttcgagatcctcgctggggacgtgtt
attgaaagtagtggtgaagatccatttgtagctagtactctcgcgcaggcggtagtaaag
ggttttcaaggggatgatccgtctaagccagatagactgttagcgtgtgctaagcatttt
attggctatggtgccgctgaaggtggccgagactatgatacgactgagataacggataat
accctgcataacgtgtatctcccctcttttaaagcggcagttgatgcaggtgtggcgacg
ttgatgtctggttttaatgatcttggcggtactccagtgaccgcgtgccgcgctttaatt
cgagattggctaaaagagcagcagaagtttgatggggtcgtcgtgagtgattggggttcg
atttcagatttagcatatttcggtgttgcaaacgatgaatccgaagctgcgaagcaggcg
ttgctggctggagttgatatagcaatgacgaataaggcgtatgagggggtgcttgatgca
ctcgttatagatgacccgaaattgatgaaataccttgatgatgctgtattacgagtgctg
aaagctaagtttcgagcaggcttgttcgaatcgccatacgtagatccgaagttacatcag
actgtgctcggtcatccgcagcatcaacaatgggctcgtgagttggctcaacaatcaatg
gtattactaaagaatcaaagtcaaatactgccattacccaatgaaggcctgaaaattgct
gtaattggcccacacgctcatagtcaacgacagcacttaggttcatggtgtttggatggc
gacagtcgggatgtagtttcaatctacgaaggtattaagctgcatggcgggatcaataca
ataatgactgaagattcgacgttcagcgatgagatggttgaatgtgcacatcttgcagat
gttgtggttttatgcgtcggagaaagtcacagacgtaccggagaagcaaggaatattgct
gaattgacgctacctgctggtcaggaggatctgatacatgcagttggccgcacgggtaaa
ccattaatagttgtacagtgtacggggcgacctgtaccgtcacctgcaactgagcaacat
gctaatgcactgctgtacgcgtggcaaagcggtactgaaactggcagggttgttgctgat
ttactgtttggtgatgtatcacctagtggaaaattaacaatgacggttccacgaactacg
ggtcaaatccctatgtattatgctcgcaaacctgtcggtaagatgcgcgacttcagagag
tatcaagcatataaggactttgattgtagtccattatatccgtttggttttggattaact
tatagtcagtttcattatgatgacttaagtgccgctaaacaaaatgatggcagtttacgt
gttgttgttcgtttgacgaacaccggatcagtgcaagcatctgaggtggtgcaatgttat
ttggcccactcacatgcatcaactactcgaccaagtcgagaactcaaggcgtttgctcgt
gtttgtctgtctgcaggcgagaatgaaaaagtggtaatgaatatttcggcagagcaactc
attcactatggggccgataagaaatggcgacttgaatccgggaagattacattgttcgta
ggcagcgattcaacctgcggtttatcgacctctgtggatgtataa

DBGET integrated database retrieval system