KEGG   Vagococcus teuberi: BHY08_02545Help
Entry
BHY08_02545       CDS       T04578                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
vte  Vagococcus teuberi
Pathway
vte00561  Glycerolipid metabolism
vte00640  Propanoate metabolism
vte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BHY08_02545 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BHY08_02545 (gldA)
Enzymes [BR:vte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     BHY08_02545 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: APB30803
UniProt: A0A1J0A4E1
Position
529121..530254
Genome map
AA seq 377 aa AA seqDB search
MRKAFISPSKYVQGEDELLNLGYYVKTFGKTALLIAHQDDINRVQEKLDKTAEKFGITFI
PSHFNGECSRGEVARLQAFAKENKADCVIGLGGGKAIDTSKCVAEGDNLIIVPTIAATDA
PTSHSAVLYTEDGEFDDYAYFKQSPSVVMVDTTIIANAPTRFLVSGMGDALSTLFEARAT
ANSFSNVNAGLPNGYVTKETAPAKNTIAAYTLAKVCYETLLENGYSAKIACDNNIVTPAL
ENIVETNILLSGLGFESSGLAAVHAIHDGLTALEGTHSYFHGEKVAFSVICQLVLENASQ
KELHEVLDFSLSIGLPVCLEDIGVESITFEEAMEVAEKACIPEESIHSMPFPIVEEEVAA
AIIAADKIGRDYKAKHK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcatttattagtccatcaaaatatgtacaaggtgaagatgaattactgaat
ttaggttattatgttaaaacatttggaaagacagctcttttaatcgcacatcaagacgat
attaatcgtgtgcaagaaaaattagataaaacagcagaaaaatttggtataacatttatc
ccgagtcattttaatggtgaatgctcacgtggtgaagtagcaagattacaagcttttgcg
aaagaaaataaagcagattgtgtgattggtttaggtggtggtaaagccatagatacgtca
aaatgtgtagctgaaggagataatttaattattgtgccaacaattgctgcaaccgacgct
ccaacaagtcattcagctgttttatatactgaagatggtgagtttgatgactatgcttac
tttaaacaaagtccaagcgtggtaatggttgatacaacaattatcgcaaacgctccgaca
agatttttagtgtcaggtatgggggatgcgttatcaacattatttgaagcccgtgcaaca
gcgaattcattttcaaatgttaacgctggattaccaaatggttatgtgacaaaagaaaca
gcaccagctaaaaatacgattgcagcttacacattagctaaagtgtgttatgaaacatta
cttgaaaatggctacagtgccaaaatagcatgtgacaataacatcgtgacaccagcatta
gaaaacattgttgagacaaatatcttattatctggtttaggatttgaaagtagtggttta
gctgctgttcacgcgattcatgatggattgactgcattagaaggaactcattcatacttc
catggtgaaaaagttgcctttagtgtgatttgtcaattagttttagaaaatgcctcacaa
aaagaattacatgaagtacttgattttagtttatcaattggcttaccagtttgtttagaa
gatattggtgtggaaagcattacatttgaagaagcaatggaagtggctgaaaaagcatgt
atacctgaagaatcaattcattctatgcctttccctattgttgaagaagaagttgcggct
gccattattgcagcagataagattggtcgtgactacaaagcgaaacataaataa

DBGET integrated database retrieval system