KEGG   Vibrio tubiashii: IX91_01815Help
Entry
IX91_01815        CDS       T03445                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
vtu  Vibrio tubiashii
Pathway
vtu00270  Cysteine and methionine metabolism
vtu00480  Glutathione metabolism
vtu01100  Metabolic pathways
Module
vtu_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:vtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    IX91_01815
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    IX91_01815
Enzymes [BR:vtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     IX91_01815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AIW12949
UniProt: F9SZG6
Position
1:complement(351456..352403)
Genome map
AA seq 315 aa AA seqDB search
MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMHDLHLDQGVAIADTKVVELK
EDPNAWYEFKSEQTIELSELDAVLMRKDPPFDTEYIYATYILERAEEQGTLIVNKPQSLR
DCNEKLFTAWFPDLTPTTIVTRKADKIKAFREEHGDVILKPLDGMGGASIFRVKENDPNV
SVIIETLTNHSQNYAMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG
TGEARPLSETDKKIAEAVAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCIREIEAAFDVS
ITGKLMDAIERRLKA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaattaggtatcgtaatggacccaatctcgtccattaacatcaaaaaagactct
agctttgccatgatgcttgaagcgcagcgccgcggctacgaaattcactacatggaaatg
cacgacctacatctagatcaaggtgtagccattgcagataccaaagttgttgaactaaaa
gaagatccaaacgcttggtatgagttcaagtcggagcaaactattgaactgtctgagtta
gatgccgtattgatgcgtaaagatcctccgtttgatactgagtacatctacgcgacatac
attctagagcgcgctgaagagcaaggcacattgatcgtcaacaagccgcaaagcctacgt
gactgtaatgaaaagttattcacggcttggttccctgacctcactccgaccacgattgtg
acgcgtaaagcagataagattaaagctttccgtgaagagcatggtgatgtgatcctaaaa
cctcttgatggcatgggtggcgcttcgatcttccgcgttaaagaaaacgatcctaacgtt
tcggtgatcattgaaaccttgaccaatcatagtcaaaactacgcaatggcgcagactttc
gttcctgatatcagcaatggcgacaaacgaattcttgtcgttgacggcgaaccaatgcct
tactgtttggcgcgaattccagccaaaggcgagactcgcggtaacttagcggcaggtggc
acaggtgaagctcgaccacttagtgagacagataaaaagatcgctgaggctgtagcgcct
acacttaaagaaaaaggactgatctttgttggtctcgacgttattggtgacaagctgaca
gaaatcaatgtaacaagcccaacatgtattcgtgaaatcgaggctgcattcgatgtgtca
attacaggcaagctaatggatgccattgagcgccgcttaaaagcctaa

DBGET integrated database retrieval system