KEGG   Vibrio tubiashii: IX91_20835Help
Entry
IX91_20835        CDS       T03445                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vtu  Vibrio tubiashii
Pathway
vtu00071  Fatty acid degradation
vtu00072  Synthesis and degradation of ketone bodies
vtu00280  Valine, leucine and isoleucine degradation
vtu00310  Lysine degradation
vtu00362  Benzoate degradation
vtu00380  Tryptophan metabolism
vtu00620  Pyruvate metabolism
vtu00630  Glyoxylate and dicarboxylate metabolism
vtu00640  Propanoate metabolism
vtu00650  Butanoate metabolism
vtu00900  Terpenoid backbone biosynthesis
vtu01100  Metabolic pathways
vtu01110  Biosynthesis of secondary metabolites
vtu01120  Microbial metabolism in diverse environments
vtu01130  Biosynthesis of antibiotics
vtu01200  Carbon metabolism
vtu01212  Fatty acid metabolism
vtu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IX91_20835
   00630 Glyoxylate and dicarboxylate metabolism
    IX91_20835
   00640 Propanoate metabolism
    IX91_20835
   00650 Butanoate metabolism
    IX91_20835
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IX91_20835
   00072 Synthesis and degradation of ketone bodies
    IX91_20835
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IX91_20835
   00310 Lysine degradation
    IX91_20835
   00380 Tryptophan metabolism
    IX91_20835
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IX91_20835
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IX91_20835
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IX91_20835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vtu04147]
    IX91_20835
Enzymes [BR:vtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IX91_20835
Exosome [BR:vtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IX91_20835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF3948
Motif
Other DBs
NCBI-ProteinID: AIW16530
UniProt: F9T107
Position
2:complement(1160659..1161870)
Genome map
AA seq 403 aa AA seqDB search
MEQKEIWIVSAKRTPMGKFQGLLADYSSPQLGALAIQGALEQAQLSPYEVDEVYMGCVLP
AGCGQAPARQAALGGGLEQSTPCTTVNKVCGSGMKSVMLAYDLIKLGSIQCAVAGGMESM
TNAPYLMKESRSGMRMGHKTTYDHMFLDGLQDAYEGELMGVYGQQIADQLEFTREQMDEW
ATQSVHRALAADKQNMFGDELVSISLKSGETLNYDEQPRSIDANKIPKLKPAFAKEGSIT
AANSSAISDGAAALILMESEKASRLEMKPLAIIKAHSTHARKPSEFTVAPVYAIEQLLSS
LDWEVEDVDLWEINEAFAVVTQIAVKELQLDSSKVNIKGGACALGHPIGASGARILTTLI
YSLRQLQAYGVDGDATKRKPMKGVAAICIGGGEATAIAIEIPV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaaaagagatttggatagtgtcagcgaaacggactcccatgggaaagtttcaa
ggtttgttggctgattactcttcaccacagctaggcgcactagcgatacaaggtgcgctt
gaacaggctcaactatcaccctatgaagtggatgaagtctatatggggtgcgtgctgcct
gcagggtgtggtcaagcgcctgccagacaagcggctttgggcggtggccttgagcaaagt
accccttgcaccacagtaaacaaagtttgtggctcaggaatgaaatcggtgatgttggca
tatgacttaatcaaattgggctcgattcaatgtgcggttgctggtggtatggagagcatg
acaaacgccccttacctaatgaaagaatctcgcagcggcatgcgaatggggcataaaacc
acctatgaccacatgttcttagatggactgcaagacgcctacgagggcgaacttatgggt
gtttatggccaacaaattgccgatcaactggagttcacacgtgagcaaatggatgaatgg
gcaacacaatctgttcatcgagctctcgcagcggataaacagaatatgtttggtgatgag
ctggtgtctatttcactcaaaagcggcgagacgctcaactatgacgagcagccacgttct
atcgacgccaataaaatccccaagctaaagcctgcttttgccaaagagggttcaatcacc
gcagccaactctagtgcgatatctgacggcgctgctgcgttgatcttgatggaatctgaa
aaggcgagtcgtcttgaaatgaaacctctcgcgatcatcaaagcgcattccacacacgcg
cgaaagccttcggagtttacagttgcgcctgtctacgcgattgaacaattactctcgtcc
ttagattgggaggttgaagacgtggatttgtgggaaatcaatgaagcctttgctgtcgtt
acacaaatcgcggtgaaagagcttcagcttgatagtagcaaagtcaacattaaaggcgga
gcatgcgcattggggcacccgatcggtgcgagcggcgcgagaattttgacgactttgata
tatagcctcagacaacttcaggcgtacggtgttgatggggatgcaaccaagcgtaaaccc
atgaaaggggtcgcggcaatttgtattggtggtggtgaagcaacagcaattgccatcgag
attccagtttaa

DBGET integrated database retrieval system