KEGG   Vibrio tubiashii: IX91_20995Help
Entry
IX91_20995        CDS       T03445                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
vtu  Vibrio tubiashii
Pathway
vtu00670  One carbon pool by folate
vtu01100  Metabolic pathways
vtu01120  Microbial metabolism in diverse environments
vtu01200  Carbon metabolism
Module
vtu_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:vtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    IX91_20995
Enzymes [BR:vtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     IX91_20995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AIW16560
UniProt: F9T7K5
Position
2:1200184..1201932
Genome map
AA seq 582 aa AA seqDB search
MLSDIEICRETKLHPISQVAERAGLHANEFHSQGKHKAKVSLHSLKRLQENSTGKLILVT
AITPTPLGEGKTVTTIGLSQGIAKLKRSVLACIRQPSMGPVFGVKGGAAGGGYSQVAPME
ELNLHLTGDIHAVTAAHNLAAAAIDARIYHEQRQGYKDFEQRSGLTALKIDPQRVVWKRV
MDHNDRALRMVTVGQNEANKTINGFERQDGFDISAASELMAILALASDLKDLRARIGRIV
VAYNIEGKPITTEDLQVAGAMAVSMKEAIEPTLMQTLEGVPTLIHAGPFANIAHGNSSII
ADNIATKLCDYTVTEGGFGSDMGFEKACNIKAQMSDKSPDCAVIVATLRGLKANSGHYDL
KPGQTIPDSLFENDESALIAGFENLKWHINNVNKYGVPAVVAINRFPQDSDQELQALKAM
IEALPNDVEVAISEGFARGGEGTLELAKKVVAQCDKTAHFKPLYQFSQTTEEKLMAVAEA
GYGACGITLSYQARKQLDELKQHGFDNLAVCLAKTPLSISTNGSIKGAPSGFDVPIRELR
LCAGAGFVYALCGNVMTMPGLPERPAFMNLDLDDEGNIIGLS
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctgatattgagatctgtcgcgagacaaaactacacccaatttctcaagttgct
gagcgtgccggtttgcatgccaacgagttccatagccaaggaaaacacaaggctaaagta
agtttgcacagtctcaaacgtctgcaggaaaactcaactggcaagcttattctggttacc
gcgattacgccaacgccacttggcgaaggtaaaacagtgacgacgattggtctgtctcag
ggcattgccaaactcaaacgttcagtcttggcatgtatacgccaaccttcaatgggccct
gtatttggagtcaaaggtggcgcggcaggcggcggttactctcaggtggctccaatggaa
gagttaaacctgcaccttacaggtgatattcatgcggttaccgcagcgcacaacttagcc
gcagcggccatagatgctcgtatctatcacgagcaacgtcaaggctataaagactttgaa
cagcgcagtggtttgactgctctcaaaatcgaccctcagcgcgttgtttggaagcgtgtc
atggaccacaatgaccgagcattgcgcatggttactgtcggtcaaaatgaagccaataaa
acgattaatggcttcgaacgccaagatggatttgatatctcagccgcttctgagcttatg
gcgattcttgctctcgcttctgatttaaaagaccttcgagctcgtattggccgtatagtt
gttgcttacaacatcgaaggcaaacctatcaccacggaagatttgcaggtcgcaggcgcc
atggccgtcagcatgaaagaagcgattgagccaaccttgatgcaaaccttagaaggcgtt
ccaacgcttatccacgcaggcccgtttgctaatattgctcatggtaactcatcgataatc
gctgacaacatcgcgacaaaactgtgtgattacaccgtcactgaaggtggatttggttca
gatatggggttcgagaaagcgtgtaatatcaaagctcaaatgtcagataaatcacccgat
tgtgctgtgatagtggctacactgcgcggcctcaaagcgaactctgggcactacgatcta
aaaccaggtcaaacgatacctgattcgctatttgaaaatgacgagagcgccctcattgca
ggcttcgaaaacctaaaatggcatattaacaacgtcaacaagtacggtgtgcctgcggtc
gttgcgatcaaccgcttcccgcaagatagtgaccaagaacttcaagcgctaaaagctatg
attgaagcgttaccaaatgatgtcgaagtcgctatcagcgaagggttcgctagaggtggc
gaagggacactagagctagcaaagaaagtcgttgctcaatgtgacaaaacagctcacttc
aagccgctgtatcaatttagccaaacaaccgaagagaagttaatggctgtggctgaagca
ggttatggcgcatgtggtatcactcttagttaccaagcaagaaaacaacttgatgagtta
aaacagcatggcttcgacaacttagcggtttgccttgcaaaaacaccactgtctatttcc
accaatggcagcattaaaggtgcgccttctggcttcgatgtgccaatccgtgagttacga
ctgtgtgcgggtgcgggctttgtctacgcgctgtgtggcaacgtaatgacgatgccgggc
ttaccagagaggcctgcgtttatgaatctcgatctcgatgacgaaggcaatattattggc
ttaagctaa

DBGET integrated database retrieval system