KEGG   Vibrio tubiashii: IX91_21060Help
Entry
IX91_21060        CDS       T03445                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
vtu  Vibrio tubiashii
Pathway
vtu00260  Glycine, serine and threonine metabolism
vtu01100  Metabolic pathways
vtu01110  Biosynthesis of secondary metabolites
vtu01120  Microbial metabolism in diverse environments
vtu01130  Biosynthesis of antibiotics
vtu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    IX91_21060
Enzymes [BR:vtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     IX91_21060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AIW16573
UniProt: F9T7J2
Position
2:1215647..1216654
Genome map
AA seq 335 aa AA seqDB search
MDFRSDTVTKPTEAMRKAMAEALVGDDVYGDDPTVNELEQWAAERHGFEAALFTTSGTQA
NLLGLMAHCERGDEYLCGQQAHNYKYEAGGAAVLGSIQPQPIENNPDGTLDFTKLKAAIK
PDDSHFARTKLLSLENTINGKVLPLSYLAEAREFVNQHNLSLHLDGARVYNAAVALDVDV
KEIAQHFDSMTICLSKGLCAPIGSLLLGSKTFIAKARRLRKMVGGGMRQAGILASAGKLA
LTEQVTQLNVDHQNAKKLALGLSELDGFHVNPDFVQTNIVFAKLDDSIQINKIAEQLAED
GITVSPGNPIRFVTHKDVSSADIDLLLSKLAQYIK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggattttcgttcagatacggtaactaagcctaccgaggcaatgcgcaaagcaatggcc
gaagcacttgtaggcgatgatgtgtatggtgacgacccaaccgtaaacgaactagagcaa
tgggcagctgagcgacacgggtttgaagcggcgctctttacgacttctggcactcaagcc
aacttactcggtcttatggctcactgtgaacgcggcgatgaatatctatgtggtcaacaa
gcccacaactataagtacgaagctggaggcgctgcggtgttaggttctatccagcctcaa
ccgatcgaaaacaacccagatggcacgttagattttacgaaactcaaagccgctattaag
cctgacgattcacactttgcccgcactaagttattaagcttagaaaacaccattaacggc
aaggtgctaccactctcctacttggcagaagcaagagaattcgtcaatcaacataacttg
tcacttcacctagatggcgctcgcgtttacaacgccgccgtcgcgcttgatgtggacgtc
aaagagattgctcagcacttcgattcgatgacgatttgtttatcaaaaggcttgtgtgcg
cctatcggctctctccttcttggtagcaaaacctttatcgccaaagctcgcaggctacgt
aaaatggtaggtggcggtatgcgccaagctggcattttggcatcagcaggtaaactggca
ttgactgaacaagtcacgcaactgaatgttgaccatcaaaatgcgaagaagttagcacta
ggactaagcgaattagacggattccatgtgaaccctgatttcgttcaaactaatatcgtc
tttgctaaattggatgacagtatccaaatcaacaagattgcggaacagttagctgaggat
ggaatcactgtgtcaccgggtaacccgattcgtttcgtgactcacaaagacgtttcaagc
gctgatatcgacctattactgagtaaacttgcgcaatacatcaaataa

DBGET integrated database retrieval system