KEGG   Vigna unguiculata (cowpea): 114162520Help
Entry
114162520         CDS       T06017                                 

Definition
(RefSeq) biotin--protein ligase 2-like isoform X1
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
vun  Vigna unguiculata (cowpea)
Pathway
vun00780  Biotin metabolism
vun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vun00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    114162520
Enzymes [BR:vun01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     114162520
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     114162520
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     114162520
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     114162520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C BPL_LplA_LipB_2
Motif
Other DBs
NCBI-GeneID: 114162520
NCBI-ProteinID: XP_027902241
Position
9
AA seq 360 aa AA seqDB search
MLLPNPSWTASLLSAATRRLYNHRFSTSSFMASSALDCSLLVLCGKSLAENETAKAIKTS
NTLKLPENGEYSLVLHSQLDKTVMQGCFQIHSFMNSLSTNQFGRLLIWSPQLTSTQDIVS
QNFCELPIGTVCVADVQTKGRGRSKNVWESPSGCLMFSFTLQMEDGRVVPLVQYVVSLAI
TEAVKDICYKNGLPSIDVKIKWPNDLYLNGSKVGGILCTSTYKSKKFNVSAGIGLNVNNE
KPTTSLNTVLKELSTGAYQFQREDILAAFFNKFEEFYGLFVNQGFQTLEELYIKTWLHSG
QRVVVQEKNGDKVIEHVVTIQGLTSTGYLLAVGDDNQMCELHPDGNSFDFFKGLVRRKLD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgcctaacccttcgtggacagcgtcgttgctatcagccgccacaagaaggctc
tacaaccaccgcttttctacatcttcgttcatggcgtcttcagctttggactgcagtttg
ctggttttgtgtggaaaatcattggcagagaatgaaactgccaaagctataaaaaccagt
aacactctcaaactccccgagaatggagaatactccctcgttttgcattcgcagctggat
aaaactgttatgcaagggtgttttcaaattcactcctttatgaattctctttccaccaat
caatttggcaggcttctcatctggtcccctcagttgacttcaacacaagatatcgtttca
caaaacttttgtgagcttcccattggtacagtttgtgtcgctgatgttcagaccaaggga
cgaggtcggtctaagaatgtctgggaatctccatcgggttgccttatgttttcttttact
ttgcaaatggaggatggaagagtcgttcctttagttcagtatgtggtttccctggctatc
acagaggcagtcaaggatatctgttacaaaaatggattacccagcatagatgttaaaatc
aagtggccaaatgatctttacttaaatggctctaaagttggaggcattctttgcacctcg
acatataaatcaaagaagttcaacgttagtgcaggaataggcttgaacgtgaataatgag
aagccaacaacatccttaaatacagttctaaaagagttgtctacaggagcttaccaattt
caaagagaagatattctagcagccttttttaacaaatttgaagagttttatggtttattt
gtgaatcaaggatttcagaccctagaggagctctatattaagacatggttgcacagtgga
cagagagttgttgtacaagaaaagaatggggacaaagtgatcgagcacgtcgtaactatt
caggggttgacatcaactggatatttattagctgtcggtgatgacaatcaaatgtgtgag
ctccaccctgatggtaatagctttgactttttcaaaggactagtcagaagaaaactcgac
tga

DBGET integrated database retrieval system