KEGG   Vigna unguiculata (cowpea): 114163920Help
Entry
114163920         CDS       T06017                                 

Definition
(RefSeq) proline-rich receptor-like protein kinase PERK7
Organism
vun  Vigna unguiculata (cowpea)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase DAP10 Adeno_E3_CR2 Pkinase_fungal TMEM154 EphA2_TM APH Orthoreo_P10 LapA_dom CD34_antigen
Motif
Other DBs
NCBI-GeneID: 114163920
NCBI-ProteinID: XP_027904108
Position
9
AA seq 628 aa AA seqDB search
MASDSPPSSDNSSPPPPPPDNSSPPPPPDNSSPPPPPPDNSSPRPPSQDNSPPPPSSSDK
KSPPPPSNSSPSTSPPPPPDKKSGNRRSSPPPHSGHQFSPPPPSKNRLSPPKSLSSRSSG
DGGSQSLSTPIIIAIAAAAGILLLLLLMVIFACSRRKRKSQSPNNYYHNQPNDGFHKNEY
GYNSNKVEHVMHIPPHPNPHSQDPNLYPPHPHPLPVGSWSAPQGVSSDMSSASYSGPHGP
VLPPPHPTVALGFNQSTFTYEELSAATGGFSQHNLLGQGGFGYVHKGVLPNGKEIAVKSL
KATSGQGDREFQAEVEIISRVHHRHLVSLVGYCISQANKLLVYEFVPNNTLEYHLHRKVQ
PVMDWNTRLKIAIGSAKGLAYLHEDCHPRIIHRDIKGANILLENNFEAKVADFGLAKMSQ
DTNTHVSTRVMGTFGYLAPEYASSGKLTDKSDVFSFGIMLLELITGREPVDNTGEYEDSL
ADWARPLCTKAMEDGIFEGLVDPRLQGNYDERQMSCMVACAAFSVRYSAKKRPKMSQIVR
VLEGDVSVQVLGHEGTKPGQSTVFGGEGEYNAEKYGADMMKFRKLALQSGSEFSATSEYG
MNPSTTSSEHSSAEYVNARRVGARMHTP
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgattccccaccatcgtcggacaattcatctcctccgccaccaccgcccgac
aattcatctcctcccccaccaccagacaactcatctccaccaccaccaccgccggacaat
tcatctcctcgtccaccgtcacaggacaattcaccacctcctccctcgtcaagcgataag
aaatctccgcccccgccatctaattcctcaccatctacatcgccaccacctcctcctgat
aagaaatcaggtaaccgccggtcatcgccgcccccacattctggccatcagttttctcct
cccccaccttcaaagaaccggttgtctccacccaagtcattatcttcgaggtcatcagga
gacggtggaagccaatcattgagcacgccaattataatagcaattgcagctgcagctggg
attttgctccttctccttctcatggtcatctttgcgtgttcaagaagaaaaaggaaatct
cagtcacccaataattactaccataatcaacctaatgatgggtttcacaaaaacgagtat
gggtacaacagcaataaggttgagcacgttatgcatattcctccacatccaaatccacat
tcacaagatccaaatctatatccaccacatccacatccacttccagttggaagttggtca
gcaccccagggtgttagttctgacatgagcagtgccagttactctgggccccatggtccc
gttttgccaccgccgcaccccacggtggccctcggattcaaccaaagcaccttcacttac
gaggagctctcggctgcgactggtggctttagccaacacaacctgctgggccagggtggc
tttggatacgtccacaaaggtgttctacccaatggcaaggaaattgcagtgaagagcctc
aaagccactagtggtcaaggagacagagaattccaagctgaggttgaaatcatcagccgc
gtccaccatcgccatctcgtctcactcgtcggctattgcatctcacaagccaacaagctc
ctcgtttatgagtttgtgcctaacaataccctcgaataccaccttcatcgaaaggttcaa
cctgtgatggattggaataccaggctcaaaattgcgattggatcggctaaaggacttgca
tatttacatgaggattgtcaccctcgtatcattcaccgagacataaagggtgcaaacatt
ctactcgaaaacaacttcgaagccaaagtggcagattttgggttggcaaagatgagtcaa
gacactaacactcacgtttctactcgtgtaatgggaacattcgggtatttggctccagaa
tatgcatcaagcggtaagctaactgacaaatctgatgtgttctcgttcggtattatgctt
ttggagctcataacaggtcgggaacctgttgacaacactggggaatatgaagatagtttg
gccgactgggctagaccactctgtacaaaggcaatggaggatggaatttttgaagggctg
gtggatccacgtttacagggtaattacgacgagcgccaaatgtcttgtatggtggcttgt
gctgcatttagcgtaaggtactctgcaaagaagcggccgaaaatgagtcagattgtgaga
gtgctggagggtgatgtgtcagtacaagtgcttggtcacgagggaacgaaacctggacaa
agtacagtgttcggcggcgaaggggaatataacgcggagaaatacggtgctgacatgatg
aagttcagaaaactagcattacagagtggcagtgagtttagtgcaacgagtgaatatggc
atgaacccttccaccacaagcagtgaacattcttctgctgaatatgtcaatgccagaagg
gtaggagctcgaatgcacactccttaa

DBGET integrated database retrieval system