KEGG   Vigna unguiculata (cowpea): 114167259Help
Entry
114167259         CDS       T06017                                 

Definition
(RefSeq) nucleoside diphosphate kinase 1
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
vun  Vigna unguiculata (cowpea)
Pathway
vun00230  Purine metabolism
vun00240  Pyrimidine metabolism
vun01100  Metabolic pathways
vun01110  Biosynthesis of secondary metabolites
vun04016  MAPK signaling pathway - plant
Module
vun_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
vun_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
vun_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:vun00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114167259
   00240 Pyrimidine metabolism
    114167259
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    114167259
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vun04131]
    114167259
Enzymes [BR:vun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     114167259
Membrane trafficking [BR:vun04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    114167259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 114167259
NCBI-ProteinID: XP_027908086
Position
10
AA seq 149 aa AA seqDB search
MAEQTFIMIKPDGVQRGLVGEIIARFEKKGFYLKGLKLISVERAFAEKHYADLSAKPFFS
GLVDYIISGPVVAMIWEGKNVVLTGRKIIGATNPAQSEPGTIRGDYAIDIGRNVIHGSDS
VESARKEIALWFPDGSVNWQSSQHSWIYE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcaaaccttcatcatgatcaagcctgatggcgttcagagaggccttgttggt
gagatcattgccagatttgagaagaaaggtttctacttgaaaggtttgaaactaatcagt
gtggagcgtgcttttgctgaaaagcactatgctgatttatctgccaagcctttcttcagt
ggattggtggattacattatctctggccctgttgttgccatgatttgggagggcaaaaat
gttgtgcttactggccgaaagataattggagccactaacccagctcaatctgagcctgga
actattcgtggtgactatgctattgacattggaaggaatgttatccatggaagtgattca
gttgagagtgctcgcaaggaaattgcattgtggttccctgatggctctgttaactggcaa
agctcccaacactcttggatctatgagtaa

DBGET integrated database retrieval system