KEGG   Vigna unguiculata (cowpea): 114167459Help
Entry
114167459         CDS       T06017                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase LECRK2
Organism
vun  Vigna unguiculata (cowpea)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr B_lectin S_locus_glycop APH YukC PIP49_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 114167459
NCBI-ProteinID: XP_027908356
Position
2
AA seq 783 aa AA seqDB search
MSLPIFLPSIFILLSLLNGFHAIVQPNTSITAGSNSTWKSPSGHFEFGFLHLPSGLFLLG
IWFARISDITLAWYLSPPVEPNSQIQFTSAGNLVVVHPNGTTANTIYDSEEGAAATSADM
QDDGNFVIKDSKLVSVWQSFNYPTNTILPGQTLLSTKTLYSKGKGPSNYSLGSFLLQMQD
DGDWVLKAYQWLDPAYWYISTITSNVTLVFNATTALMYLVAGTGNIYSITNTTPTPVEDY
YHRATIDENGNFQQYAYHKRNGTGWRRVWRAVEDPCRVNAVCGVYGLCSSPDNESVKCEC
IPGYIPFDDRDISKGCHPPAVINYCAENNFKLQVFDDTDFHFNTHLVSLAGVDFESCKKD
VIDDCNIVAATYDHSTSTCAKKRLPLLNARNSSSSKGLKALLKVAHRIESGTYTKKKIFN
VKILLKVLVAVTATLACFFGALAVYYHPFTRKLTIRKKHLNATAMGINFREFTFQELCEA
TKGFTKILGKGASGRVYRGALVIDDAEIDVAVKKLEKKIDKSETEFTTELKIIGRTHHRN
LVRLLGFCIESSHRILVYELMPHGALSSYLFGEGERPEWGQRIEMALGVARGLLYLHEEC
NTQIIHCDIKPENVLLDANYTPKIADFGLSKLLNKDQTRTNTNLRGTMGYLAPEWLRSAP
VTAKVDIYSFGVMLLEIICCRRHVEICEDGKDSEDYDLVLSNFVLRCVVCRQLEVVVRDD
TEVLNDFKRFEEMALIGLWCVHPNPALRPSMKHVMQMLDGTVEVGVPPLVYEQIMACSLS
LQC
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgcctatctttctcccttccattttcatactactttcacttctgaatggattc
catgccattgtacaaccaaacaccagcatcactgctggatcaaactctacatggaagtca
ccctcgggtcattttgaatttggattcctccatcttcccagtggtctctttcttttggga
atatggtttgcgagaatctcagatataacactcgcatggtacctctctcctcctgtggaa
ccaaattcccaaatccaattcacttctgcaggaaaccttgtggttgtacacccaaatggg
actactgctaacaccatatacgattcagaagaaggtgctgctgcaacttctgctgacatg
caagatgatggcaattttgtcatcaaggactccaaattagtatctgtatggcagagtttc
aactatccaaccaacactatcttaccgggccaaacattgctcagtactaaaaccctctat
tccaagggcaaaggaccttcaaactactcgttgggaagtttcctattacaaatgcaagat
gatggcgactgggtgctcaaagcgtaccagtggttagaccctgcatactggtacatttca
accataacctccaatgtgactttggtgtttaatgccaccactgctctcatgtaccttgtc
gccggcaccgggaacatctactctataaccaacaccactccaaccccggtggaggattac
tatcaccgtgctacaatagatgagaatgggaatttccagcaatacgcttatcacaagagg
aatgggaccggttggaggagggtttggagagctgtggaggatccctgcagagtgaatgct
gtctgtggtgtgtatggcttgtgcagttctcctgacaatgaatcagtaaagtgtgagtgt
attccaggttatatccctttcgatgatcgagatatttcaaaagggtgtcatccaccagct
gtcataaattactgtgcagagaacaacttcaaactccaggtctttgacgacactgatttc
cattttaatactcatcttgttagcttagctggtgttgacttcgaaagttgtaagaaggat
gtaatagatgattgtaacattgttgctgcaacttatgaccattccacctccacatgtgcc
aagaagagactgcccttactgaatgctagaaatagctcttcttcaaagggactgaaagca
ctgcttaaggttgctcacaggattgaatctggaacatatactaagaagaaaatttttaat
gtaaaaatccttttaaaggttcttgttgcagttactgcaactcttgcctgtttctttggt
gcccttgctgtctactatcatcctttcactcggaaactaacaataagaaagaagcatctg
aatgcaacagctatgggaatcaacttcagagaattcacctttcaggagctgtgtgaagca
acaaagggatttactaagattcttggaaagggagcttctggcagagtctatcgtggtgct
ctagtgatagatgatgcagagattgatgttgcagtaaagaaactggaaaagaaaatagac
aaaagtgagactgaattcacgactgagctaaaaattattggccgtactcatcatagaaat
ttggtgaggcttttggggttttgcattgagagtagccatcgaattcttgtgtatgagttg
atgccacacggtgccctctctagttatttgtttggagagggagaaaggcctgaatggggt
cagaggattgaaatggctcttggagtcgcaagagggttgctatacttgcacgaagagtgc
aacacccaaatcatacattgtgacataaagcccgaaaatgtgttacttgatgccaattac
acaccaaagattgcagattttggactgtcgaagcttttgaacaaagatcaaactagaaca
aacactaacttaagaggaacgatgggatacctggcacctgaatggctaaggagtgcacca
gtaactgcgaaagttgacatatacagttttggggttatgttattggagattatttgctgc
aggaggcacgttgagatttgtgaggatggaaaagacagtgaagattatgatttggttctt
tcaaattttgttttaaggtgtgtggtgtgtaggcaactagaggtagtggtgagagatgac
acagaagtgctgaatgatttcaagaggtttgaggaaatggccttgattggactgtggtgt
gttcatccaaatcctgctttaagaccttcaatgaagcacgtaatgcaaatgctagatgga
acagtggaagttggtgttcctcctttggtttatgagcagatcatggcctgtagtttatca
ctgcagtgctaa

DBGET integrated database retrieval system