KEGG   Vigna unguiculata (cowpea): 114169885Help
Entry
114169885         CDS       T06017                                 

Definition
(RefSeq) serine/threonine-protein kinase-like protein At3g51990
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
vun  Vigna unguiculata (cowpea)
Brite
KEGG Orthology (KO) [BR:vun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vun01001]
    114169885
Enzymes [BR:vun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114169885
Protein kinases [BR:vun01001]
 Serine/threonine kinases: TKL group
  IRAK family
   114169885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH
Motif
Other DBs
NCBI-GeneID: 114169885
NCBI-ProteinID: XP_027911066
Position
11
AA seq 504 aa AA seqDB search
MGYLYLSCRAESAVSTSDSVASSSREKEKEKERSSIKIQEFQYSDLEAATNGFSDRKLLG
KGSHGYVYKAVVRGRPVAVKRPSRPHHHGVVVPRPVVSSSAPVEITNEVDNEIDILSKIQ
SPRLVNLVGFTNDSRDRLLVVEFMSNGTLYDVLHSSPRPPNWGRRIRLALQTAKAIDTLH
SSTPPVIHRDIKSANVLIDRSYNARLGDFGLALRGHVDDYRLRSTPPAGTMGYLDPCYVT
PDNLSTKTDVFSFGILLLEIISGRKAIDITYSPPSIVDWAIPLIKKGKLLAVYDPRIAPP
KDPVVRKQLAVIAAKCVRSCRERRPSMKEVVTWLCGLCKLVPLHSWNGFNNPCMMVETVG
RPVEARNGEFGVEEGKFEALDGRLSKSAMRYSRRVYSDLGFSSNLMDLMATTEEPEFLRD
SDGVVEHSSKSAEQVSSSRFGSGRYSIRGRNLYKPCGSDKDAFGLSKGQIVVGQNETTSK
QNEVSGSNSKNLNLNLNSLVAEVV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggggtatctatacctttcttgcagagccgaatccgcagtttcaacttccgattcggtg
gcttcttcttccagagagaaagagaaagagaaagagagaagcagcatcaagatccaggag
tttcagtacagcgaccttgaagctgctaccaatggcttctccgaccggaagcttctcgga
aaagggagtcacgggtatgtgtacaaggcggtggttcgggggcgtcccgtggcggtgaag
cggccgtcgcggccgcatcatcacggggttgttgttcctcgaccggtggtgtcgtcttcc
gcgccggtggagatcacgaacgaggtggacaacgagatcgacatcttgtcgaaaatccag
agccccaggttggtgaatttggtgggtttcacgaacgattcaagagacaggcttttggtg
gtggagttcatgagcaatgggaccctttacgatgttcttcattcctctccaaggcctccc
aattggggtaggaggattcgtctggctctgcaaaccgcgaaagccattgacacgcttcac
tcctcgacgccgccggtgattcaccgtgacataaagtctgcgaacgttctcatcgaccgg
agctacaatgcgagattaggggattttggtttggctctgagaggccatgttgatgactac
agactcaggtccactccccctgcaggcaccatgggttaccttgacccttgttatgtgact
cctgataatttgagcaccaaaaccgatgttttcagctttgggattttgctgctggagatt
ataagcggaagaaaagccattgacatcacttattcaccaccttctatcgtggattgggct
attcccctcataaaaaaagggaagcttttggctgtttatgatcctagaattgcacctccc
aaggatcctgttgtgaggaagcaattggctgtgattgctgcaaagtgtgtgaggtcttgc
agagagagaagaccctccatgaaggaggttgttacatggctctgtgggttgtgtaaactg
gtgcctcttcattcctggaatggtttcaacaacccttgcatgatggttgagactgtgggg
cgccccgttgaagcaaggaacggtgaattcggtgtggaagagggaaagtttgaagctttg
gatggaagactttcaaagtctgcaatgaggtattccagaagggtgtattctgatttgggg
ttcagcagcaacttgatggatttgatggccaccactgaggagcctgaatttctgagagat
tctgatggggtggtggagcatagttctaaatctgctgaacaagtttctagctccaggttt
ggcagtggaaggtattccataagagggaggaacctatacaagccatgtggcagtgacaag
gacgcatttggcttgagtaaaggccagattgttgttggtcagaatgagaccacttcaaaa
cagaacgaggtttctggttcaaattcgaagaatttgaatttgaatttgaactctctggtt
gctgaggttgtctag

DBGET integrated database retrieval system