KEGG   Vigna unguiculata (cowpea): 114176652Help
Entry
114176652         CDS       T06017                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
vun  Vigna unguiculata (cowpea)
Pathway
vun03013  RNA transport
Brite
KEGG Orthology (KO) [BR:vun00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    114176652
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:vun03012]
    114176652
Translation factors [BR:vun03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    114176652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI DUF711
Motif
Other DBs
NCBI-GeneID: 114176652
NCBI-ProteinID: XP_027917566
Position
1
AA seq 957 aa AA seqDB search
MTSFLKPENALKRAEELINVGQKQDALQTLHDLITSKRYRAWQKTLERIMFKYVELCVDM
RKGRFAKDGLIQYRIICQQVNVSSLEEVIKHFMHLSTEKAEQARSQAQALEEALDVDDLE
ADKRPEDLMLSYVSGEKGKDRSDRELVTPWFKFLWETYRTVLELLRNNSKLEALYAMTAH
RAFQFCKQYKRTTEFRRLCEIIRNHLANLNKYRDQRDRPDLSAPESLQLYLDTRVEQLKI
ATELELWQEAFRSVEDIHGLMCLVKKTPKPSLMVVYYVKLTEIFWISSSHLYHAYAWFRL
FLLQKSFNKNLSQKDLQLIASSVVLAALSVPPHDRTHGASHLELEHEKERNLRMANLIGF
NLETKPESREMLSRSSLLAELASKGVMSCVTQEVKDVYHLLEHEFHPSDLAVKALPLITK
ISKLGGKLSTASSVPEVQLSQYVPALERLATMRLLQQVSNVYQTMKIETLSGMIPFFDFS
VVEKIAVDAVKQKFVSMKVDHMKNVVIFCKTSLESDGLRDHLANFAEQLNKARQMIYPPD
RKPSKLGALLPTLTEVVAKEHKRLLARKSIIEKRKEEQERQLLEMEREEESKRLRLQKIT
EEAEQRRLATEYEQRKNQRILREIEEREIEEAQALLQEAEKRIKKKGKKPIIEGDKITKQ
TLMELTLTEQLRERQEMEKKLQKLAKTMDYLERAKREEAAPLIEAAYQQRLVEERLLHER
EQQQEVELSKQRHEGDLKEKERLARMMGNKEIYEVRVVSHRQAEFNRLRREREERISRIL
QSRRQEREKMRKLKYYLKLEEERQQKMREEEEARKREEAERRKKEEAERLAKLAEIAEKQ
RQRERELEEKERQRREALLGRSVEAAPPARQSEPVTAPAAAAAAAAAAPNPGKYVPKFMR
DRAERTGTAPPPETDRWGGNSSSRPDGDRWRGGDDRRSSYVSGGGSRSSSSWSRNPR
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atgacatctttcctaaagcctgagaatgctctcaaaagggccgaagagttaatcaatgtt
gggcagaagcaggatgctctacagactcttcatgacctcattacctcaaagagatacaga
gcatggcagaagacacttgaaaggattatgtttaagtatgttgaactttgtgttgacatg
cgcaagggccgatttgcaaaagatgggcttattcagtataggataatatgtcagcaagtc
aatgttagttcactggaggaggtgatcaaacactttatgcacctgtcaactgagaaagct
gaacaagctcggagtcaagcacaagcgttggaagaagcccttgatgttgatgatttagag
gctgataaaaggccagaggacttgatgttgagttatgtcagtggtgagaaagggaaggac
agatctgatcgggagcttgttaccccatggtttaaatttctctgggaaacttacaggaca
gtgcttgaattattgcgaaacaactcaaaactggaagcattatacgctatgacagctcat
cgagctttccagttctgcaagcaatataaacgaacaacagagttccgcagactgtgcgaa
atcataagaaaccatttggctaatctcaacaaataccgtgaccaacgagacaggcctgac
ctttcagcacctgaaagcttacaattgtatcttgatactagagttgagcagctgaaaatt
gccactgaacttgaactctggcaggaagccttcagatcagtggaggatatacatggactg
atgtgcttggtcaagaaaactcccaagccatccttgatggttgtttactatgtgaagctg
acagaaatattttggatatcgtcaagtcatctttatcatgcatatgcatggttcaggctc
tttttattgcaaaaaagcttcaataagaacctgagtcagaaggatttgcaattaatagct
tcatctgttgttcttgctgcactttcagtgcctcctcatgaccgtacacatggtgcgtct
cacttggaactggagcatgaaaaagagagaaatttgaggatggccaatctcattggcttt
aatcttgagactaaacctgaaagcagagaaatgctctcaagatcatcacttcttgctgaa
ctggcatccaagggagtgatgtcttgtgtgactcaggaagtgaaagatgtttaccatctt
ttggaacatgaatttcatccctcagatcttgcagtaaaagcgctgcccttgataactaaa
atctcaaagttaggaggcaagctttctacagcttcttctgttcccgaagtacagttgtct
caatatgtcccagcattggaaagactagctaccatgaggttgctgcagcaggtgtccaac
gtttaccagacaatgaagatagagactttatctgggatgatcccgttctttgacttttcc
gtagttgaaaagattgccgtagatgctgtaaagcagaagtttgtatcaatgaaagttgat
cacatgaaaaatgttgtgatcttttgcaaaacgagtctcgagtcagatggcttaagggat
cacttggccaattttgctgaacaattaaataaggcccgacaaatgatttatcctcctgat
aggaaaccatctaaacttggagctttacttccaactttgactgaggttgttgccaaagaa
cacaagaggcttcttgctcgaaaatcaatcattgagaaacggaaagaagaacaagaacgg
cagcttcttgaaatggaacgagaggaggagtcaaaaagactaagacttcagaaaataact
gaagaagcagaacaaagacggcttgccaccgagtatgagcagaggaagaatcagaggatc
cttagggagatagaagagagggaaattgaagaagctcaagctttacttcaggaagctgaa
aagcgtatcaaaaagaaggggaaaaagccaatcatagagggagacaaaatcaccaagcag
accttgatggagttaactttgactgaacaactccgggaaagacaggaaatggaaaagaag
ttgcagaagttagcgaaaacaatggattatttggaaagagcgaaaagagaggaagctgct
ccccttattgaagctgcgtatcaacaacgtttagtggaagagagacttcttcatgagcgt
gaacaacagcaagaagttgaactgagcaaacagaggcatgagggagatctcaaggagaag
gagaggcttgctcgaatgatgggcaataaggagatatatgaggtccgagttgttagtcat
cgccaagcagagtttaatagattaagaagagaacgggaagagcgaatctctaggattttg
cagtcaaggagacaggagagggaaaaaatgaggaagttgaagtattatctcaaattagaa
gaagagagacaacaaaaaatgcgtgaggaggaggaagcacggaaacgtgaagaggctgaa
aggagaaagaaggaagaggctgaacgcttagcaaaactggcggagatagctgaaaaacag
aggcagagagagcgggaacttgaagaaaaagagagacaaaggagagaagcattgttaggc
agaagtgttgaagcagctcctcctgcgcggcaatcggaacctgtaacagctcctgctgca
gctgcagccgctgccgctgcagctccaaacccagggaaatatgtgcctaagttcatgcga
gatagagctgaaagaacaggcactgctcctcctccggaaacagaccgctggggtggtaac
agtagcagcaggccggatggtgacaggtggcgtggtggtgatgatcggcgaagtagttat
gttagtggtggaggttcaaggtcatcatcttcttggtccaggaatccgcgttga

DBGET integrated database retrieval system