KEGG   Vigna unguiculata (cowpea): 114179265Help
Entry
114179265         CDS       T06017                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vun  Vigna unguiculata (cowpea)
Pathway
vun00480  Glutathione metabolism
vun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vun00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    114179265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vun02000]
    114179265
Enzymes [BR:vun01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     114179265
Transporters [BR:vun02000]
 Other transporters
  Pores ion channels [TC:1]
   114179265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_3 GST_C_5 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 114179265
NCBI-ProteinID: XP_027921332
Position
3
AA seq 219 aa AA seqDB search
MGNDEVVLVDFDLSMFCVRVKIALAEKGVEFESRKEDLVNTKSELLLQMNPVYKMVPVLI
HNGKPISESLIIVEYIDEVWRDRTPLLPTDPYQRAQARFWADFVDHKVHEIGKRIWTGKI
GEHEEDKKELVENLKQLEEALGDMPYFGGHTFGFVDIALIPFYKWFSSFEKIGNFKLHCP
KITAWANRCLVRESVSKYVSDEKDVNDFVLSYRKLIGMD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgatgaggttgtgttggttgattttgatctgagcatgttctgtgtaagagtg
aagattgctctggcagagaaaggtgtagagtttgagagcaggaaagaggatctggtgaac
accaagagtgaactgcttctgcaaatgaaccctgtttacaaaatggttcctgttcttatc
cacaatggcaagccaatctctgaatctctcatcattgttgagtatattgatgaggtttgg
agggataggactcctcttttgcccactgatccctatcagagagctcaagccaggttctgg
gctgattttgttgatcataaggtgcatgaaattggaaagaggatatggactgggaagata
ggtgaacatgaggaagataagaaggagttagtagagaatttgaagcaattggaagaggct
cttggggacatgccatattttggaggtcacacatttgggtttgttgatattgctttgatt
cccttttacaaatggttctcttcttttgagaaaattggcaacttcaagctccactgtcca
aaaatcactgcttgggcaaacagatgtttggtgagagaaagtgtgtccaaatatgtttct
gatgagaaggatgtgaatgactttgttctgagctataggaaattaattgggatggactga

DBGET integrated database retrieval system